Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  DISCOVERY OF A SELECTIVE TRK INHIBITOR WITH EFFICACY IN RODENT CANCER TUMOR MODELS
 
Authors :  A. Kreusch
Date :  16 Dec 11  (Deposition) - 08 Feb 12  (Release) - 08 Feb 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Kinase Domain, Kinase, Phosphorylation, Transferase-Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  P. Albaugh, Y. Fan, Y. Mi, F. Sun, F Adrian, N. Li, Y. Yia, Y. Sarkisova, A. Kreusch, T. Hood, M. Lu, G. Liu, S. Huang, Z. Liu, J. Loren, T. Tuntland, D. S. Karanewsky, H. M. Seidel, V. Molteni
Discovery Of Gnf-5837, A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models
Acs Med. Chem. Lett. 2012
PubMed: search  |  Reference-DOI: 10.1021/ML200261D

(-) Compounds

Molecule 1 - NT-3 GROWTH FACTOR RECEPTOR
    ChainsA, B
    EC Number2.7.10.1
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System PlasmidPFASTBAC
    Expression System StrainSF9
    Expression System Taxid7108
    Expression System Vector TypePLASMID
    FragmentKINASE DOMAIN (UNP RESIDUES 530-818)
    GeneNTRK3, TRKC
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymGP145-TRKC, TRK-C, NEUROTROPHIC TYROSINE KINASE RECEPTOR TYPE 3, TRKC TYROSINE KINASE

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric Unit (2, 3)
No.NameCountTypeFull Name
10F42Ligand/Ion1-(3-{[(3Z)-2-OXO-3-(1H-PYRROL-2-YLMETHYLIDENE)-2,3-DIHYDRO-1H-INDOL-6-YL]AMINO}PHENYL)-3-[3-(TRIFLUOROMETHYL)PHENYL]UREA
2CL1Ligand/IonCHLORIDE ION
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
10F41Ligand/Ion1-(3-{[(3Z)-2-OXO-3-(1H-PYRROL-2-YLMETHYLIDENE)-2,3-DIHYDRO-1H-INDOL-6-YL]AMINO}PHENYL)-3-[3-(TRIFLUOROMETHYL)PHENYL]UREA
2CL-1Ligand/IonCHLORIDE ION
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
10F41Ligand/Ion1-(3-{[(3Z)-2-OXO-3-(1H-PYRROL-2-YLMETHYLIDENE)-2,3-DIHYDRO-1H-INDOL-6-YL]AMINO}PHENYL)-3-[3-(TRIFLUOROMETHYL)PHENYL]UREA
2CL-1Ligand/IonCHLORIDE ION

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:535 , ILE A:538 , LEU A:540 , ARG B:535 , ILE B:538 , LEU B:540BINDING SITE FOR RESIDUE CL A 901
2AC2SOFTWAREALA A:570 , LYS A:572 , GLU A:588 , LEU A:591 , LEU A:592 , ILE A:600 , PHE A:617 , GLU A:618 , TYR A:619 , MET A:620 , GLY A:623 , LEU A:670 , PHE A:675 , HIS A:677 , LEU A:686 , ILE A:695 , GLY A:696 , ASP A:697 , PHE A:698BINDING SITE FOR RESIDUE 0F4 A 902
3AC3SOFTWARELEU B:544 , ALA B:570 , LYS B:572 , GLU B:588 , LEU B:592 , LEU B:595 , ILE B:600 , PHE B:617 , GLU B:618 , TYR B:619 , MET B:620 , GLY B:623 , LEU B:670 , PHE B:675 , HIS B:677 , LEU B:686 , ILE B:695 , GLY B:696 , ASP B:697 , PHE B:698BINDING SITE FOR RESIDUE 0F4 B 901

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3V5Q)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Asp A:611 -Pro A:612
2Lys B:575 -Asp B:576

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (11, 22)

Asymmetric Unit (11, 22)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_074605I533FNTRK3_HUMANDisease869112057A/BI533F
02UniProtVAR_046521A664SNTRK3_HUMANUnclassified  ---A/BA664S
03UniProtVAR_041475H677YNTRK3_HUMANUnclassified  ---A/BH677Y
04UniProtVAR_041476R678QNTRK3_HUMANPolymorphism55890138A/BR678Q
05UniProtVAR_046770R735FNTRK3_HUMANUnclassified  ---A/BR735F
06UniProtVAR_046522W736CNTRK3_HUMANUnclassified  ---A/BW736C
07UniProtVAR_046523R745PNTRK3_HUMANUnclassified  ---A/BR745P
08UniProtVAR_046524Y766FNTRK3_HUMANUnclassified  ---A/BY766F
09UniProtVAR_046771K768RNTRK3_HUMANPolymorphism55770052A/BK768R
10UniProtVAR_046772E781KNTRK3_HUMANPolymorphism56393451A/BE781K
11UniProtVAR_074606I817MNTRK3_HUMANDisease869209165A/BI817M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (11, 11)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_074605I533FNTRK3_HUMANDisease869112057AI533F
02UniProtVAR_046521A664SNTRK3_HUMANUnclassified  ---AA664S
03UniProtVAR_041475H677YNTRK3_HUMANUnclassified  ---AH677Y
04UniProtVAR_041476R678QNTRK3_HUMANPolymorphism55890138AR678Q
05UniProtVAR_046770R735FNTRK3_HUMANUnclassified  ---AR735F
06UniProtVAR_046522W736CNTRK3_HUMANUnclassified  ---AW736C
07UniProtVAR_046523R745PNTRK3_HUMANUnclassified  ---AR745P
08UniProtVAR_046524Y766FNTRK3_HUMANUnclassified  ---AY766F
09UniProtVAR_046771K768RNTRK3_HUMANPolymorphism55770052AK768R
10UniProtVAR_046772E781KNTRK3_HUMANPolymorphism56393451AE781K
11UniProtVAR_074606I817MNTRK3_HUMANDisease869209165AI817M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (11, 11)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_074605I533FNTRK3_HUMANDisease869112057BI533F
02UniProtVAR_046521A664SNTRK3_HUMANUnclassified  ---BA664S
03UniProtVAR_041475H677YNTRK3_HUMANUnclassified  ---BH677Y
04UniProtVAR_041476R678QNTRK3_HUMANPolymorphism55890138BR678Q
05UniProtVAR_046770R735FNTRK3_HUMANUnclassified  ---BR735F
06UniProtVAR_046522W736CNTRK3_HUMANUnclassified  ---BW736C
07UniProtVAR_046523R745PNTRK3_HUMANUnclassified  ---BR745P
08UniProtVAR_046524Y766FNTRK3_HUMANUnclassified  ---BY766F
09UniProtVAR_046771K768RNTRK3_HUMANPolymorphism55770052BK768R
10UniProtVAR_046772E781KNTRK3_HUMANPolymorphism56393451BE781K
11UniProtVAR_074606I817MNTRK3_HUMANDisease869209165BI817M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 6)

Asymmetric Unit (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.NTRK3_HUMAN544-572
 
  2A:544-572
B:544-572
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.NTRK3_HUMAN675-687
 
  2A:675-687
B:675-687
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.NTRK3_HUMAN703-711
 
  2A:703-711
B:703-711
Biological Unit 1 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.NTRK3_HUMAN544-572
 
  1A:544-572
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.NTRK3_HUMAN675-687
 
  1A:675-687
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.NTRK3_HUMAN703-711
 
  1A:703-711
-
Biological Unit 2 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.NTRK3_HUMAN544-572
 
  1-
B:544-572
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.NTRK3_HUMAN675-687
 
  1-
B:675-687
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.NTRK3_HUMAN703-711
 
  1-
B:703-711

(-) Exons   (6, 12)

Asymmetric Unit (6, 12)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2bENST000003609482bENSE00001400416chr15:88799661-88799515147NTRK3_HUMAN-00--
1.3ENST000003609483ENSE00002158319chr15:88799399-88799137263NTRK3_HUMAN1-83830--
1.4ENST000003609484ENSE00001696452chr15:88727530-8872745675NTRK3_HUMAN83-108260--
1.5ENST000003609485ENSE00001608071chr15:88726720-8872664972NTRK3_HUMAN108-132250--
1.6ENST000003609486ENSE00001700495chr15:88690634-8869056669NTRK3_HUMAN132-155240--
1.7ENST000003609487ENSE00001796940chr15:88680792-88680635158NTRK3_HUMAN155-208540--
1.8ENST000003609488ENSE00001663999chr15:88679840-88679698143NTRK3_HUMAN208-255480--
1.9ENST000003609489ENSE00001741518chr15:88679271-88679130142NTRK3_HUMAN256-303480--
1.10ENST0000036094810ENSE00001805730chr15:88678628-88678332297NTRK3_HUMAN303-4021000--
1.11ENST0000036094811ENSE00001766954chr15:88671965-8867194224NTRK3_HUMAN402-41090--
1.12ENST0000036094812ENSE00001754979chr15:88670457-8867039365NTRK3_HUMAN410-431220--
1.13ENST0000036094813ENSE00001595872chr15:88669604-88669502103NTRK3_HUMAN432-466350--
1.14ENST0000036094814ENSE00001654221chr15:88576276-88576088189NTRK3_HUMAN466-529642A:-3--1
B:-3--1
3
3
1.17ENST0000036094817ENSE00001134154chr15:88483984-88483854131NTRK3_HUMAN529-572442A:-1-572 (gaps)
B:-1-572 (gaps)
44
44
1.18ENST0000036094818ENSE00000943684chr15:88476415-88476243173NTRK3_HUMAN573-630582A:573-630 (gaps)
B:573-630 (gaps)
58
58
1.20ENST0000036094820ENSE00000943685chr15:88472665-88472422244NTRK3_HUMAN630-711822A:630-711 (gaps)
B:630-711 (gaps)
82
82
1.21ENST0000036094821ENSE00000943688chr15:88428966-8842892542NTRK3_HUMAN712-725140--
1.22ENST0000036094822ENSE00001766468chr15:88423659-88423501159NTRK3_HUMAN726-778532A:730-778
B:730-778
49
49
1.23aENST0000036094823aENSE00001134128chr15:88420351-88420022330NTRK3_HUMAN779-839612A:779-832
B:779-832
54
54

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:263
 aligned with NTRK3_HUMAN | Q16288 from UniProtKB/Swiss-Prot  Length:839

    Alignment length:306
                                   536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736       746       756       766       776       786       796       806       816       826      
          NTRK3_HUMAN   527 DTYVQHIKRRDIVLKRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYRLFNPSGNDFCIWCEVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATP 832
               SCOP domains d3v5qa_ A: automat      ed matches                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eehhh.eeeeee.------.eeeeeee.......eeeeeeee.--.hhhhhhhhhhhhhhhhhh.......eeeee......eeeee.....hhhhhhhhh..---------------..hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.hhh.eee.....--..hhhhh..------------------...hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..........hhhhhhhhhhhh.........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------F----------------------------------------------------------------------------------------------------------------------------------S------------YQ--------------------------------------------------------FC--------P--------------------F-R------------K-----------------------------------M--------------- SAPs(SNPs)
                    PROSITE -----------------PROTEIN_KINASE_ATP           ------------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.1-------------------------------------------Exon 1.18  PDB: A:573-630 (gaps) UniProt: 573-630         ---------------------------------------------------------------------------------Exon 1.21     Exon 1.22  PDB: A:730-778 UniProt: 726-778           Exon 1.23a  PDB: A:779-832 UniProt: 779-839            Transcript 1 (1)
           Transcript 1 (2) --Exon 1.17  PDB: A:-1-572 (gaps)             ---------------------------------------------------------Exon 1.20  PDB: A:630-711 (gaps) UniProt: 630-711                                 ------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3v5q A  -3 GIHVQHIKRRDIVLKREL------KVFLAECYNLSPTKDKMLVAVKAL--PTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGP---------------ELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGM--DVYSTDYYR------------------TMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATP 832
                              ||   536       | -    |  556       566       | -|      586       596       606       616       626       | -         -   |   656       666       676       686       696   |  |706    |    -         -   |   736       746       756       766       776       786       796       806       816       826      
                             -1|           544    551                    574  |                                                      634             650                                               700  |     711                730                                                                                                      
                             530                                            577                                                                                                                           703                                                                                                                                 

Chain B from PDB  Type:PROTEIN  Length:265
 aligned with NTRK3_HUMAN | Q16288 from UniProtKB/Swiss-Prot  Length:839

    Alignment length:306
                                   536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736       746       756       766       776       786       796       806       816       826      
          NTRK3_HUMAN   527 DTYVQHIKRRDIVLKRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYRLFNPSGNDFCIWCEVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATP 832
               SCOP domains d3v5qb_ B: automate    d matches                                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eehhh.eeeeee..----.eeeeeeee.......eeeeeeee....hhhhhhhhhhhhhhhhhh.......eeeee..--..eeeee....eehhhhhhh...---------------..hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.hhh.eee.....--..hhhhh..------------------...hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..........hhhhhhhhhhhh.........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------F----------------------------------------------------------------------------------------------------------------------------------S------------YQ--------------------------------------------------------FC--------P--------------------F-R------------K-----------------------------------M--------------- SAPs(SNPs)
                    PROSITE -----------------PROTEIN_KINASE_ATP           ------------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.1-------------------------------------------Exon 1.18  PDB: B:573-630 (gaps) UniProt: 573-630         ---------------------------------------------------------------------------------Exon 1.21     Exon 1.22  PDB: B:730-778 UniProt: 726-778           Exon 1.23a  PDB: B:779-832 UniProt: 779-839            Transcript 1 (1)
           Transcript 1 (2) --Exon 1.17  PDB: B:-1-572 (gaps)             ---------------------------------------------------------Exon 1.20  PDB: B:630-711 (gaps) UniProt: 630-711                                 ------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3v5q B  -3 GIHVQHIKRRDIVLKRELG----FKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHIVKFYGVCGD--PLIMVFEYMKHGDLNKFLRAHGP---------------ELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGM--DVYSTDYYR------------------TMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATP 832
                              ||   536        |-   |   556       566       576       586       596       606  |  | 616       626       | -         -   |   656       666       676       686       696   |  |706    |    -         -   |   736       746       756       766       776       786       796       806       816       826      
                             -1|            545  550                                                        609  |                   634             650                                               700  |     711                730                                                                                                      
                             530                                                                               612                                                                                        703                                                                                                                                 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3V5Q)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3V5Q)

(-) Gene Ontology  (56, 56)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (NTRK3_HUMAN | Q16288)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0005004    GPI-linked ephrin receptor activity    Combining with a GPI-anchored ephrin to initiate a change in cell activity.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0043121    neurotrophin binding    Interacting selectively and non-covalently with a neurotrophin, any of a family of growth factors that prevent apoptosis in neurons and promote nerve growth.
    GO:0005030    neurotrophin receptor activity    Combining with a neurotrophin, any of a family of growth factors that prevent apoptosis in neurons and promote nerve growth, and transmitting the signal to initiate a change in cell activity.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0002039    p53 binding    Interacting selectively and non-covalently with one of the p53 family of proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004713    protein tyrosine kinase activity    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0004714    transmembrane receptor protein tyrosine kinase activity    Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
biological process
    GO:0090630    activation of GTPase activity    Any process that initiates the activity of an inactive GTPase through the replacement of GDP by GTP.
    GO:0000187    activation of MAPK activity    The initiation of the activity of the inactive enzyme MAP kinase (MAPK).
    GO:0032148    activation of protein kinase B activity    Any process that initiates the activity of the inactive enzyme protein kinase B.
    GO:0030154    cell differentiation    The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
    GO:0071300    cellular response to retinoic acid    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a retinoic acid stimulus.
    GO:0007623    circadian rhythm    Any biological process in an organism that recurs with a regularity of approximately 24 hours.
    GO:0090102    cochlea development    The progression of the cochlea over time from its formation to the mature structure. The cochlea is the snail-shaped portion of the inner ear that is responsible for the detection of sound.
    GO:0048013    ephrin receptor signaling pathway    The series of molecular signals generated as a consequence of an ephrin receptor binding to an ephrin.
    GO:0007507    heart development    The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
    GO:0070306    lens fiber cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of a lens fiber cell, any of the elongated, tightly packed cells that make up the bulk of the mature lens in the camera-type eye. The cytoplasm of a lens fiber cell is devoid of most intracellular organelles including the cell nucleus, and contains primarily crystallins, a group of water-soluble proteins expressed in vary large quantities.
    GO:0042490    mechanoreceptor differentiation    The process in which a relatively unspecialized cell acquires specialized features of a mechanoreceptor, a cell specialized to transduce mechanical stimuli and relay that information centrally in the nervous system.
    GO:0019056    modulation by virus of host transcription    Any process in which a virus modulates the frequency, rate or extent of its host's transcription.
    GO:0007275    multicellular organism development    The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
    GO:0048712    negative regulation of astrocyte differentiation    Any process that stops, prevents, or reduces the frequency, rate or extent of astrocyte differentiation.
    GO:0060548    negative regulation of cell death    Any process that decreases the rate or frequency of cell death. Cell death is the specific activation or halting of processes within a cell so that its vital functions markedly cease, rather than simply deteriorating gradually over time, which culminates in cell death.
    GO:0001933    negative regulation of protein phosphorylation    Any process that stops, prevents or reduces the rate of addition of phosphate groups to amino acids within a protein.
    GO:0007399    nervous system development    The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
    GO:0048665    neuron fate specification    The process in which a cell becomes capable of differentiating autonomously into a neuron in an environment that is neutral with respect to the developmental pathway. Upon specification, the cell fate can be reversed.
    GO:0001764    neuron migration    The characteristic movement of an immature neuron from germinal zones to specific positions where they will reside as they mature.
    GO:0038179    neurotrophin signaling pathway    A series of molecular signals initiated by the binding of a neurotrophin to a receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription. Neurotrophins are a family of secreted growth factors that induce the survival, development, and function of neurons.
    GO:0018108    peptidyl-tyrosine phosphorylation    The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:2000251    positive regulation of actin cytoskeleton reorganization    Any process that activates or increases the frequency, rate or extent of actin cytoskeleton reorganization.
    GO:0043065    positive regulation of apoptotic process    Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
    GO:0048691    positive regulation of axon extension involved in regeneration    Any process that activates, maintains or increases the rate of axon extension involved in regeneration.
    GO:0030335    positive regulation of cell migration    Any process that activates or increases the frequency, rate or extent of cell migration.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0033138    positive regulation of peptidyl-serine phosphorylation    Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-serine.
    GO:0050927    positive regulation of positive chemotaxis    Any process that activates or increases the frequency, rate or extent of the directed movement of a motile cell or organism towards a higher concentration in a concentration gradient of a specific chemical.
    GO:0001934    positive regulation of protein phosphorylation    Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
    GO:0051965    positive regulation of synapse assembly    Any process that activates, maintains or increases the frequency, rate or extent of synapse assembly, the aggregation, arrangement and bonding together of a set of components to form a synapse.
    GO:0046777    protein autophosphorylation    The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0048678    response to axon injury    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an axon injury stimulus.
    GO:0051412    response to corticosterone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a corticosterone stimulus. Corticosterone is a 21 carbon steroid hormone of the corticosteroid type, produced in the cortex of the adrenal glands. In many species, corticosterone is the principal glucocorticoid, involved in regulation of fuel metabolism, immune reactions, and stress responses.
    GO:0045471    response to ethanol    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
    GO:0007169    transmembrane receptor protein tyrosine kinase signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0043235    receptor complex    Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    0F4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asp A:611 - Pro A:612   [ RasMol ]  
    Lys B:575 - Asp B:576   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3v5q
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NTRK3_HUMAN | Q16288
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.10.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  NTRK3_HUMAN | Q16288
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NTRK3_HUMAN | Q162881wwc 4ymj

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3V5Q)