Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
(-)Biological Unit 7
(-)Biological Unit 8
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)
Image Biological Unit 7
Biological Unit 7  (Jmol Viewer)
Image Biological Unit 8
Biological Unit 8  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE COMPLEX OF TRIM33 PHD-BROMO AND H3(1-28) K9ME3K14ACK18ACK23AC HISTONE PEPTIDE
 
Authors :  Z. Wang, D. J. Patel
Date :  11 Oct 11  (Deposition) - 18 Jan 12  (Release) - 02 Apr 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P
Biol. Unit 1:  A,I  (1x)
Biol. Unit 2:  B,J  (1x)
Biol. Unit 3:  C,K  (1x)
Biol. Unit 4:  D,L  (1x)
Biol. Unit 5:  E,M  (1x)
Biol. Unit 6:  F,N  (1x)
Biol. Unit 7:  G,O  (1x)
Biol. Unit 8:  H,P  (1x)
Keywords :  Trim33, Phd, Bromodomain, Tgf-Beta, Epigenetics, Histone, Methylation, K9Me3, K14Ac, K18Ac, K23Ac, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Q. Xi, Z. Wang, A. I. Zaromytidou, X. H. Zhang, L. F. Chow-Tsang, J. X. Liu, H. Kim, A. Barlas, K. Manova-Todorova, V. Kaartinen, L. Studer, W. Mark, D. J. Patel, J. Massague
A Poised Chromatin Platform For Tgf-Beta Access To Master Regulators
Cell(Cambridge, Mass. ) V. 147 1511 2011
PubMed-ID: 22196728  |  Reference-DOI: 10.1016/J.CELL.2011.11.032

(-) Compounds

Molecule 1 - E3 UBIQUITIN-PROTEIN LIGASE TRIM33
    ChainsA, B, C, D, E, F, G, H
    EC Number6.3.2.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPRSFDUET-1
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentTHE PHD AND BROMO DOMAIN OF TRIM33
    GeneTRIM33, KIAA1113, RFG7, TIF1G
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymECTODERMIN HOMOLOG, RET-FUSED GENE 7 PROTEIN, PROTEIN RFG7, TRANSCRIPTION INTERMEDIARY FACTOR 1-GAMMA, TIF1-GAMMA, TRIPARTITE MOTIF-CONTAINING PROTEIN 33
 
Molecule 2 - HISTONE H3.1
    ChainsI, J, K, L, M, N, O, P
    EngineeredYES
    FragmentN-TERMINAL HISTONE H3 PEPTIDE CONTAINING TRIMETHYLATED K9, ACETYLATED K14, K18 AND K23, UNP RESIDUES 2-29
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsTHIS SEQUENCE OCCURS NATURALLY IN HUMANS
    SynonymHISTONE H3
    SyntheticYES

 Structural Features

(-) Chains, Units

  12345678910111213141516
Asymmetric Unit ABCDEFGHIJKLMNOP
Biological Unit 1 (1x)A       I       
Biological Unit 2 (1x) B       J      
Biological Unit 3 (1x)  C       K     
Biological Unit 4 (1x)   D       L    
Biological Unit 5 (1x)    E       M   
Biological Unit 6 (1x)     F       N  
Biological Unit 7 (1x)      G       O 
Biological Unit 8 (1x)       H       P

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 36)

Asymmetric Unit (3, 36)
No.NameCountTypeFull Name
1ALY12Mod. Amino AcidN(6)-ACETYLLYSINE
2M3L8Mod. Amino AcidN-TRIMETHYLLYSINE
3ZN16Ligand/IonZINC ION
Biological Unit 1 (2, 3)
No.NameCountTypeFull Name
1ALY2Mod. Amino AcidN(6)-ACETYLLYSINE
2M3L1Mod. Amino AcidN-TRIMETHYLLYSINE
3ZN-1Ligand/IonZINC ION
Biological Unit 2 (2, 2)
No.NameCountTypeFull Name
1ALY1Mod. Amino AcidN(6)-ACETYLLYSINE
2M3L1Mod. Amino AcidN-TRIMETHYLLYSINE
3ZN-1Ligand/IonZINC ION
Biological Unit 3 (2, 2)
No.NameCountTypeFull Name
1ALY1Mod. Amino AcidN(6)-ACETYLLYSINE
2M3L1Mod. Amino AcidN-TRIMETHYLLYSINE
3ZN-1Ligand/IonZINC ION
Biological Unit 4 (2, 3)
No.NameCountTypeFull Name
1ALY2Mod. Amino AcidN(6)-ACETYLLYSINE
2M3L1Mod. Amino AcidN-TRIMETHYLLYSINE
3ZN-1Ligand/IonZINC ION
Biological Unit 5 (2, 3)
No.NameCountTypeFull Name
1ALY2Mod. Amino AcidN(6)-ACETYLLYSINE
2M3L1Mod. Amino AcidN-TRIMETHYLLYSINE
3ZN-1Ligand/IonZINC ION
Biological Unit 6 (2, 2)
No.NameCountTypeFull Name
1ALY1Mod. Amino AcidN(6)-ACETYLLYSINE
2M3L1Mod. Amino AcidN-TRIMETHYLLYSINE
3ZN-1Ligand/IonZINC ION
Biological Unit 7 (2, 3)
No.NameCountTypeFull Name
1ALY2Mod. Amino AcidN(6)-ACETYLLYSINE
2M3L1Mod. Amino AcidN-TRIMETHYLLYSINE
3ZN-1Ligand/IonZINC ION
Biological Unit 8 (2, 2)
No.NameCountTypeFull Name
1ALY1Mod. Amino AcidN(6)-ACETYLLYSINE
2M3L1Mod. Amino AcidN-TRIMETHYLLYSINE
3ZN-1Ligand/IonZINC ION

(-) Sites  (16, 16)

Asymmetric Unit (16, 16)
No.NameEvidenceResiduesDescription
01AC1SOFTWARECYS A:890 , CYS A:893 , HIS A:910 , CYS A:913BINDING SITE FOR RESIDUE ZN A 1
02AC2SOFTWARECYS A:902 , CYS A:905 , CYS A:928 , CYS A:931BINDING SITE FOR RESIDUE ZN A 2
03AC3SOFTWARECYS B:890 , CYS B:893 , HIS B:910 , CYS B:913BINDING SITE FOR RESIDUE ZN B 1
04AC4SOFTWARECYS B:902 , CYS B:905 , CYS B:928 , CYS B:931BINDING SITE FOR RESIDUE ZN B 2
05AC5SOFTWARECYS C:890 , CYS C:893 , HIS C:910 , CYS C:913BINDING SITE FOR RESIDUE ZN C 1
06AC6SOFTWARECYS C:902 , CYS C:905 , CYS C:928 , CYS C:931BINDING SITE FOR RESIDUE ZN C 2
07AC7SOFTWARECYS D:890 , CYS D:893 , HIS D:910 , CYS D:913BINDING SITE FOR RESIDUE ZN D 1
08AC8SOFTWARECYS D:902 , CYS D:905 , CYS D:928 , CYS D:931BINDING SITE FOR RESIDUE ZN D 2
09AC9SOFTWARECYS E:890 , CYS E:893 , HIS E:910 , CYS E:913BINDING SITE FOR RESIDUE ZN E 1
10BC1SOFTWARECYS E:902 , CYS E:905 , CYS E:928 , CYS E:931BINDING SITE FOR RESIDUE ZN E 2
11BC2SOFTWARECYS F:890 , CYS F:893 , HIS F:910 , CYS F:913BINDING SITE FOR RESIDUE ZN F 1
12BC3SOFTWARECYS F:902 , CYS F:905 , CYS F:928 , CYS F:931BINDING SITE FOR RESIDUE ZN F 2
13BC4SOFTWARECYS G:890 , CYS G:893 , HIS G:910 , CYS G:913BINDING SITE FOR RESIDUE ZN G 1
14BC5SOFTWARECYS G:902 , CYS G:905 , CYS G:928 , CYS G:931BINDING SITE FOR RESIDUE ZN G 2
15BC6SOFTWARECYS H:890 , CYS H:893 , HIS H:910 , CYS H:913BINDING SITE FOR RESIDUE ZN H 1
16BC7SOFTWARECYS H:902 , CYS H:905 , CYS H:928 , CYS H:931BINDING SITE FOR RESIDUE ZN H 2

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3U5P)

(-) Cis Peptide Bonds  (8, 8)

Asymmetric Unit
No.Residues
1Val A:915 -Pro A:916
2Val B:915 -Pro B:916
3Val C:915 -Pro C:916
4Val D:915 -Pro D:916
5Val E:915 -Pro E:916
6Val F:915 -Pro F:916
7Val G:915 -Pro G:916
8Val H:915 -Pro H:916

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 16)

Asymmetric Unit (2, 16)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042379P885STRI33_HUMANUnclassified  ---A/B/C/D/E/F/G/HP885S
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622A/B/C/D/E/F/G/HV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042379P885STRI33_HUMANUnclassified  ---AP885S
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622AV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042379P885STRI33_HUMANUnclassified  ---BP885S
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622BV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042379P885STRI33_HUMANUnclassified  ---CP885S
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622CV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042379P885STRI33_HUMANUnclassified  ---DP885S
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622DV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 5 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042379P885STRI33_HUMANUnclassified  ---EP885S
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622EV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 6 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042379P885STRI33_HUMANUnclassified  ---FP885S
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622FV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 7 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042379P885STRI33_HUMANUnclassified  ---GP885S
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622GV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 8 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042379P885STRI33_HUMANUnclassified  ---HP885S
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622HV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (4, 32)

Asymmetric Unit (4, 32)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HISTONE_H3_1PS00322 Histone H3 signature 1.H31_HUMAN15-21
 
 
 
 
 
 
 
  8I:14-18
J:15-18
K:15-18
L:14-18
M:14-19
N:15-18
O:14-18
P:15-18
2ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
  8A:887-934
B:887-934
C:887-934
D:887-934
E:887-934
F:887-934
G:887-934
H:887-934
3ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
  8A:890-931
B:890-931
C:890-931
D:890-931
E:890-931
F:890-931
G:890-931
H:890-931
4BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
  8A:974-1046
B:974-1046
C:974-1046
D:974-1046
E:974-1046
F:974-1046
G:974-1046
H:974-1046
Biological Unit 1 (4, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HISTONE_H3_1PS00322 Histone H3 signature 1.H31_HUMAN15-21
 
 
 
 
 
 
 
  1I:14-18
-
-
-
-
-
-
-
2ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
  1A:887-934
-
-
-
-
-
-
-
3ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
  1A:890-931
-
-
-
-
-
-
-
4BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
  1A:974-1046
-
-
-
-
-
-
-
Biological Unit 2 (4, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HISTONE_H3_1PS00322 Histone H3 signature 1.H31_HUMAN15-21
 
 
 
 
 
 
 
  1-
J:15-18
-
-
-
-
-
-
2ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
  1-
B:887-934
-
-
-
-
-
-
3ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
  1-
B:890-931
-
-
-
-
-
-
4BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
  1-
B:974-1046
-
-
-
-
-
-
Biological Unit 3 (4, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HISTONE_H3_1PS00322 Histone H3 signature 1.H31_HUMAN15-21
 
 
 
 
 
 
 
  1-
-
K:15-18
-
-
-
-
-
2ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
  1-
-
C:887-934
-
-
-
-
-
3ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
  1-
-
C:890-931
-
-
-
-
-
4BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
  1-
-
C:974-1046
-
-
-
-
-
Biological Unit 4 (4, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HISTONE_H3_1PS00322 Histone H3 signature 1.H31_HUMAN15-21
 
 
 
 
 
 
 
  1-
-
-
L:14-18
-
-
-
-
2ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
  1-
-
-
D:887-934
-
-
-
-
3ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
  1-
-
-
D:890-931
-
-
-
-
4BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
  1-
-
-
D:974-1046
-
-
-
-
Biological Unit 5 (4, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HISTONE_H3_1PS00322 Histone H3 signature 1.H31_HUMAN15-21
 
 
 
 
 
 
 
  1-
-
-
-
M:14-19
-
-
-
2ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
  1-
-
-
-
E:887-934
-
-
-
3ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
  1-
-
-
-
E:890-931
-
-
-
4BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
  1-
-
-
-
E:974-1046
-
-
-
Biological Unit 6 (4, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HISTONE_H3_1PS00322 Histone H3 signature 1.H31_HUMAN15-21
 
 
 
 
 
 
 
  1-
-
-
-
-
N:15-18
-
-
2ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
  1-
-
-
-
-
F:887-934
-
-
3ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
  1-
-
-
-
-
F:890-931
-
-
4BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
  1-
-
-
-
-
F:974-1046
-
-
Biological Unit 7 (4, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HISTONE_H3_1PS00322 Histone H3 signature 1.H31_HUMAN15-21
 
 
 
 
 
 
 
  1-
-
-
-
-
-
O:14-18
-
2ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
  1-
-
-
-
-
-
G:887-934
-
3ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
  1-
-
-
-
-
-
G:890-931
-
4BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
  1-
-
-
-
-
-
G:974-1046
-
Biological Unit 8 (4, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HISTONE_H3_1PS00322 Histone H3 signature 1.H31_HUMAN15-21
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
P:15-18
2ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
H:887-934
3ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
H:890-931
4BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
H:974-1046

(-) Exons   (1, 8)

Asymmetric Unit (1, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2bENST000003593032bENSE00001974165chr6:27858570-27858160411H31_HUMAN1-1361368I:1-18
J:1-18 (gaps)
K:1-18 (gaps)
L:1-18
M:1-19
N:1-18 (gaps)
O:1-18
P:1-18 (gaps)
18
18
18
18
19
18
18
18

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:188
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:204
                                   893       903       913       923       933       943       953       963       973       983       993      1003      1013      1023      1033      1043      1053      1063      1073      1083    
         TRI33_HUMAN    884 DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..............eee..........................................hhhhhh..------..hhhhhhhhhhhhhhhhhh..hhhhhh.......hhhhhh....hhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhh..----------.hhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -S---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---ZF_PHD_2  PDB: A:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: A:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) ------ZF_PHD_1  PDB: A:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3u5p A  884 DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSK------GLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYA----------SEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   893       903       913       923       933       943      |  -   |   963       973       983       993      1003      1013      1023      1033      1043     |   -      1063      1073      1083    
                                                                                            950    957                                                                                        1049       1060                           

Chain B from PDB  Type:PROTEIN  Length:188
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:204
                                   893       903       913       923       933       943       953       963       973       983       993      1003      1013      1023      1033      1043      1053      1063      1073      1083    
         TRI33_HUMAN    884 DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .............eeeee......ee.................................hhhhhh..------..hhhhhhhhhhhhhhhhh...hhhhhh.......hhhhhh....hhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhh...----------.hhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -S---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---ZF_PHD_2  PDB: B:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: B:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) ------ZF_PHD_1  PDB: B:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3u5p B  884 DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSK------GLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYA----------SEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   893       903       913       923       933       943      |  -   |   963       973       983       993      1003      1013      1023      1033      1043     |   -      1063      1073      1083    
                                                                                            950    957                                                                                        1049       1060                           

Chain C from PDB  Type:PROTEIN  Length:188
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:204
                                   893       903       913       923       933       943       953       963       973       983       993      1003      1013      1023      1033      1043      1053      1063      1073      1083    
         TRI33_HUMAN    884 DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .............eeeee......ee.................................hhhhhh..------..hhhhhhhhhhhhhhhhh...hhhhhh.......hhhhhh....hhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhh..----------.hhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -S---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---ZF_PHD_2  PDB: C:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: C:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) ------ZF_PHD_1  PDB: C:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3u5p C  884 DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSK------GLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYA----------SEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   893       903       913       923       933       943      |  -   |   963       973       983       993      1003      1013      1023      1033      1043     |   -      1063      1073      1083    
                                                                                            950    957                                                                                        1049       1060                           

Chain D from PDB  Type:PROTEIN  Length:188
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:204
                                   893       903       913       923       933       943       953       963       973       983       993      1003      1013      1023      1033      1043      1053      1063      1073      1083    
         TRI33_HUMAN    884 DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..............eeee......ee.................................hhhhhh..------..hhhhhhhhhhhhhhhhh...hhhhhh.......hhhhhh....hhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhh..----------.hhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -S---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---ZF_PHD_2  PDB: D:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: D:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) ------ZF_PHD_1  PDB: D:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3u5p D  884 DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSK------GLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYA----------SEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   893       903       913       923       933       943      |  -   |   963       973       983       993      1003      1013      1023      1033      1043     |   -      1063      1073      1083    
                                                                                            950    957                                                                                        1049       1060                           

Chain E from PDB  Type:PROTEIN  Length:188
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:204
                                   893       903       913       923       933       943       953       963       973       983       993      1003      1013      1023      1033      1043      1053      1063      1073      1083    
         TRI33_HUMAN    884 DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .............eeee..........................................hhhhhh..------..hhhhhhhhhhhhhhhhh...hhhhh........hhhhhh....hhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhh..----------.hhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -S---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---ZF_PHD_2  PDB: E:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: E:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) ------ZF_PHD_1  PDB: E:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3u5p E  884 DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSK------GLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYA----------SEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   893       903       913       923       933       943      |  -   |   963       973       983       993      1003      1013      1023      1033      1043     |   -      1063      1073      1083    
                                                                                            950    957                                                                                        1049       1060                           

Chain F from PDB  Type:PROTEIN  Length:188
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:204
                                   893       903       913       923       933       943       953       963       973       983       993      1003      1013      1023      1033      1043      1053      1063      1073      1083    
         TRI33_HUMAN    884 DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .............eeeee......ee.................................hhhhhh..------..hhhhhhhhhhhhhhhhh...hhhhhh.......hhhhhh....hhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhh..----------.hhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -S---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---ZF_PHD_2  PDB: F:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: F:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) ------ZF_PHD_1  PDB: F:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3u5p F  884 DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSK------GLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYA----------SEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   893       903       913       923       933       943      |  -   |   963       973       983       993      1003      1013      1023      1033      1043     |   -      1063      1073      1083    
                                                                                            950    957                                                                                        1049       1060                           

Chain G from PDB  Type:PROTEIN  Length:188
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:204
                                   893       903       913       923       933       943       953       963       973       983       993      1003      1013      1023      1033      1043      1053      1063      1073      1083    
         TRI33_HUMAN    884 DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .............eeeee......ee...................................hhhhhh------..hhhhhhhhhhhhhhhhh...hhhhhh.......hhhhhh....hhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhh...----------.hhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -S---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---ZF_PHD_2  PDB: G:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: G:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) ------ZF_PHD_1  PDB: G:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3u5p G  884 DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSK------GLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYA----------SEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   893       903       913       923       933       943      |  -   |   963       973       983       993      1003      1013      1023      1033      1043     |   -      1063      1073      1083    
                                                                                            950    957                                                                                        1049       1060                           

Chain H from PDB  Type:PROTEIN  Length:188
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:204
                                   893       903       913       923       933       943       953       963       973       983       993      1003      1013      1023      1033      1043      1053      1063      1073      1083    
         TRI33_HUMAN    884 DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..............eeee......ee.................................hhhhhh..------..hhhhhhhhhhhhhhhhh...hhhhhh.......hhhhhh....hhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhh..----------.hhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -S---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---ZF_PHD_2  PDB: H:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: H:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) ------ZF_PHD_1  PDB: H:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3u5p H  884 DPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSK------GLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYA----------SEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   893       903       913       923       933       943      |  -   |   963       973       983       993      1003      1013      1023      1033      1043     |   -      1063      1073      1083    
                                                                                            950    957                                                                                        1049       1060                           

Chain I from PDB  Type:PROTEIN  Length:18
 aligned with H31_HUMAN | P68431 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:18
                                    11        
           H31_HUMAN      2 ARTKQTARKSTGGKAPRK   19
               SCOP domains ------------------ SCOP domains
               CATH domains ------------------ CATH domains
               Pfam domains ------------------ Pfam domains
         Sec.struct. author ..eee............. Sec.struct. author
                 SAPs(SNPs) ------------------ SAPs(SNPs)
                    PROSITE -------------HISTO PROSITE
               Transcript 1 Exon 1.2b          Transcript 1
                3u5p I    1 ARTKQTARkSTGGkAPRk   18
                                    10   |   |
                                    9-M3L|   |
                                        14-ALY
                                            18-ALY

Chain J from PDB  Type:PROTEIN  Length:16
 aligned with H31_HUMAN | P68431 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:18
                                    11        
           H31_HUMAN      2 ARTKQTARKSTGGKAPRK   19
               SCOP domains ------------------ SCOP domains
               CATH domains ------------------ CATH domains
               Pfam domains ------------------ Pfam domains
         Sec.struct. author ..eeee......--.... Sec.struct. author
                 SAPs(SNPs) ------------------ SAPs(SNPs)
                    PROSITE -------------HISTO PROSITE
               Transcript 1 Exon 1.2b          Transcript 1
                3u5p J    1 ARTKQTARkSTG--APRk   18
                                    10 |  |  |
                                    9-M3L15  |
                                            18-ALY

Chain K from PDB  Type:PROTEIN  Length:16
 aligned with H31_HUMAN | P68431 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:18
                                    11        
           H31_HUMAN      2 ARTKQTARKSTGGKAPRK   19
               SCOP domains ------------------ SCOP domains
               CATH domains ------------------ CATH domains
               Pfam domains ------------------ Pfam domains
         Sec.struct. author ..eeee......--.... Sec.struct. author
                 SAPs(SNPs) ------------------ SAPs(SNPs)
                    PROSITE -------------HISTO PROSITE
               Transcript 1 Exon 1.2b          Transcript 1
                3u5p K    1 ARTKQTARkSTG--APRk   18
                                    10 |  |  |
                                    9-M3L15  |
                                            18-ALY

Chain L from PDB  Type:PROTEIN  Length:18
 aligned with H31_HUMAN | P68431 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:18
                                    11        
           H31_HUMAN      2 ARTKQTARKSTGGKAPRK   19
               SCOP domains ------------------ SCOP domains
               CATH domains ------------------ CATH domains
               Pfam domains ------------------ Pfam domains
         Sec.struct. author ..eee............. Sec.struct. author
                 SAPs(SNPs) ------------------ SAPs(SNPs)
                    PROSITE -------------HISTO PROSITE
               Transcript 1 Exon 1.2b          Transcript 1
                3u5p L    1 ARTKQTARkSTGGkAPRk   18
                                    10   |   |
                                    9-M3L|   |
                                        14-ALY
                                            18-ALY

Chain M from PDB  Type:PROTEIN  Length:19
 aligned with H31_HUMAN | P68431 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:19
                                    11         
           H31_HUMAN      2 ARTKQTARKSTGGKAPRKQ   20
               SCOP domains ------------------- SCOP domains
               CATH domains ------------------- CATH domains
               Pfam domains ------------------- Pfam domains
         Sec.struct. author ..eeee............. Sec.struct. author
                 SAPs(SNPs) ------------------- SAPs(SNPs)
                    PROSITE -------------HISTON PROSITE
               Transcript 1 Exon 1.2b           Transcript 1
                3u5p M    1 ARTKQTARkSTGGkAPRkQ   19
                                    10   |   | 
                                    9-M3L|   | 
                                        14-ALY 
                                            18-ALY

Chain N from PDB  Type:PROTEIN  Length:16
 aligned with H31_HUMAN | P68431 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:18
                                    11        
           H31_HUMAN      2 ARTKQTARKSTGGKAPRK   19
               SCOP domains ------------------ SCOP domains
               CATH domains ------------------ CATH domains
               Pfam domains ------------------ Pfam domains
         Sec.struct. author ..eeee......--.... Sec.struct. author
                 SAPs(SNPs) ------------------ SAPs(SNPs)
                    PROSITE -------------HISTO PROSITE
               Transcript 1 Exon 1.2b          Transcript 1
                3u5p N    1 ARTKQTARkSTG--APRk   18
                                    10 |  |  |
                                    9-M3L15  |
                                            18-ALY

Chain O from PDB  Type:PROTEIN  Length:18
 aligned with H31_HUMAN | P68431 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:18
                                    11        
           H31_HUMAN      2 ARTKQTARKSTGGKAPRK   19
               SCOP domains ------------------ SCOP domains
               CATH domains ------------------ CATH domains
               Pfam domains ------------------ Pfam domains
         Sec.struct. author ..eeee............ Sec.struct. author
                 SAPs(SNPs) ------------------ SAPs(SNPs)
                    PROSITE -------------HISTO PROSITE
               Transcript 1 Exon 1.2b          Transcript 1
                3u5p O    1 ARTKQTARkSTGGkAPRk   18
                                    10   |   |
                                    9-M3L|   |
                                        14-ALY
                                            18-ALY

Chain P from PDB  Type:PROTEIN  Length:16
 aligned with H31_HUMAN | P68431 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:18
                                    11        
           H31_HUMAN      2 ARTKQTARKSTGGKAPRK   19
               SCOP domains ------------------ SCOP domains
               CATH domains ------------------ CATH domains
               Pfam domains ------------------ Pfam domains
         Sec.struct. author ..eee.......--.... Sec.struct. author
                 SAPs(SNPs) ------------------ SAPs(SNPs)
                    PROSITE -------------HISTO PROSITE
               Transcript 1 Exon 1.2b          Transcript 1
                3u5p P    1 ARTKQTARkSTG--APRk   18
                                    10 |  |  |
                                    9-M3L15  |
                                            18-ALY

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3U5P)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3U5P)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3U5P)

(-) Gene Ontology  (43, 47)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F,G,H   (TRI33_HUMAN | Q9UPN9)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0070412    R-SMAD binding    Interacting selectively and non-covalently with a receptor-regulated SMAD signaling protein.
    GO:0070410    co-SMAD binding    Interacting selectively and non-covalently with a common mediator SMAD signaling protein.
    GO:0016874    ligase activity    Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004842    ubiquitin-protein transferase activity    Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0030514    negative regulation of BMP signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of the BMP signaling pathway.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045892    negative regulation of transcription, DNA-templated    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0016567    protein ubiquitination    The process in which one or more ubiquitin groups are added to a protein.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0017015    regulation of transforming growth factor beta receptor signaling pathway    Any process that modulates the frequency, rate or extent of activity of any TGF-beta receptor signaling pathway.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain I,J,K,L,M,N,O,P   (H31_HUMAN | P68431)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0042393    histone binding    Interacting selectively and non-covalently with a histone, any of a group of water-soluble proteins found in association with the DNA of eukaroytic chromosomes. They are involved in the condensation and coiling of chromosomes during cell division and have also been implicated in nonspecific suppression of gene activity.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
biological process
    GO:0006335    DNA replication-dependent nucleosome assembly    The formation of nucleosomes on newly replicated DNA, coupled to strand elongation.
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0044267    cellular protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
    GO:0000183    chromatin silencing at rDNA    Repression of transcription of ribosomal DNA by altering the structure of chromatin.
    GO:0031047    gene silencing by RNA    Any process in which RNA molecules inactivate expression of target genes.
    GO:0045814    negative regulation of gene expression, epigenetic    Any epigenetic process that stops, prevents or reduces the rate of gene expression.
    GO:0006334    nucleosome assembly    The aggregation, arrangement and bonding together of a nucleosome, the beadlike structural units of eukaryotic chromatin composed of histones and DNA.
    GO:0002230    positive regulation of defense response to virus by host    Any host process that results in the promotion of antiviral immune response mechanisms, thereby limiting viral replication.
    GO:0045815    positive regulation of gene expression, epigenetic    Any epigenetic process that activates or increases the rate of gene expression.
    GO:0051290    protein heterotetramerization    The formation of a protein heterotetramer, a macromolecular structure consisting of four noncovalently associated subunits, of which not all are identical.
    GO:0060968    regulation of gene silencing    Any process that modulates the rate, frequency, or extent of gene silencing, the transcriptional or post-transcriptional process carried out at the cellular level that results in long-term gene inactivation.
    GO:0032200    telomere organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of telomeres, terminal regions of a linear chromosome that include the telomeric DNA repeats and associated proteins.
    GO:0098792    xenophagy    The macroautophagy process in which a region of cytoplasm containing an intracellular pathogen or some part of an intracellular pathogen (e.g. viral capsid) is enclosed in a double membrane bound autophagosome, which then fuses with the lysosome leading to degradation of the contents.
cellular component
    GO:0005694    chromosome    A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0000228    nuclear chromosome    A chromosome that encodes the nuclear genome and is found in the nucleus of a eukaryotic cell during the cell cycle phases when the nucleus is intact.
    GO:0000784    nuclear chromosome, telomeric region    The terminal region of a linear nuclear chromosome that includes the telomeric DNA repeats and associated proteins.
    GO:0000788    nuclear nucleosome    A complex comprised of DNA wound around a multisubunit core and associated proteins, which forms the primary packing unit of DNA in the nucleus into higher order structures.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0000786    nucleosome    A complex comprised of DNA wound around a multisubunit core and associated proteins, which forms the primary packing unit of DNA into higher order structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ALY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    M3L  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Val A:915 - Pro A:916   [ RasMol ]  
    Val B:915 - Pro B:916   [ RasMol ]  
    Val C:915 - Pro C:916   [ RasMol ]  
    Val D:915 - Pro D:916   [ RasMol ]  
    Val E:915 - Pro E:916   [ RasMol ]  
    Val F:915 - Pro F:916   [ RasMol ]  
    Val G:915 - Pro G:916   [ RasMol ]  
    Val H:915 - Pro H:916   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]
    Biological Unit 7  [ Jena3D ]
    Biological Unit 8  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3u5p
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  H31_HUMAN | P68431
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  TRI33_HUMAN | Q9UPN9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  6.3.2.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  H31_HUMAN | P68431
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TRI33_HUMAN | Q9UPN9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        H31_HUMAN | P684311cs9 1ct6 1guw 1o9s 1q3l 2b2t 2b2u 2b2v 2b2w 2c1j 2c1n 2cv5 2kwj 2kwk 2l75 2lbm 2m0o 2ndf 2ndg 2oq6 2ot7 2ox0 2ri7 2uxn 2v89 2vpg 2x0l 3a1b 3afa 3avr 3ayw 3aze 3azf 3azg 3azh 3azi 3azj 3azk 3azl 3azm 3azn 3b95 3kmt 3kqi 3lqi 3lqj 3o34 3o35 3o37 3qj6 3rig 3riy 3sou 3sow 3u31 3u3d 3u4s 3u5n 3u5o 3uee 3uef 3uig 3uii 3uik 3v43 3w96 3w97 3w98 3w99 3wa9 3waa 3wkj 3x1s 3x1t 3x1u 3x1v 3zg6 3zvy 4a0j 4a0n 4a7j 4bd3 4c1q 4f4u 4f56 4ft2 4ft4 4fwf 4hon 4i51 4l7x 4lk9 4lka 4llb 4lxl 4n4h 4qbq 4qbr 4qbs 4tn7 4u68 4up0 4uy4 4x3k 4y6l 4yhp 4yhz 4ym5 4ym6 4z0r 4z2m 5av5 5av6 5av8 5av9 5avb 5avc 5b24 5b2i 5b2j 5b31 5c11 5c13 5c3i 5cpi 5cpj 5cpk 5d6y 5dah 5fb0 5fb1 5ffv 5gse 5gsu 5gt0 5gt3 5gtc 5hjb 5hjc 5hjd 5hyn 5iql 5j3v 5j9s 5jhn 5jin 5jiy 5jj0 5jrg 5kjh 5kji 5kkl 5m5g 5svx 5svy 5t0k 5t0m 5t1g 5t1i 5t8r 5tbn 5tdr 5tdw 5v21 5v22 5va6
        TRI33_HUMAN | Q9UPN93u5m 3u5n 3u5o

(-) Related Entries Specified in the PDB File

3u5m 3u5n 3u5o