Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
(-)Biological Unit 7
(-)Biological Unit 8
(-)Biological Unit 9
(-)Biological Unit 10
(-)Biological Unit 11
(-)Biological Unit 12
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)
Image Biological Unit 7
Biological Unit 7  (Jmol Viewer)
Image Biological Unit 8
Biological Unit 8  (Jmol Viewer)
Image Biological Unit 9
Biological Unit 9  (Jmol Viewer)
Image Biological Unit 10
Biological Unit 10  (Jmol Viewer)
Image Biological Unit 11
Biological Unit 11  (Jmol Viewer)
Image Biological Unit 12
Biological Unit 12  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF TRIM33 PHD-BROMO IN THE FREE STATE
 
Authors :  Z. Wang, D. J. Patel
Date :  11 Oct 11  (Deposition) - 18 Jan 12  (Release) - 18 Jan 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.08
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Biol. Unit 5:  E  (1x)
Biol. Unit 6:  F  (1x)
Biol. Unit 7:  G  (1x)
Biol. Unit 8:  H  (1x)
Biol. Unit 9:  I  (1x)
Biol. Unit 10:  J  (1x)
Biol. Unit 11:  K  (1x)
Biol. Unit 12:  L  (1x)
Keywords :  Trim33, Phd, Bromodomain, Tgf-Beta, Epigenetics, Histone, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Q. Xi, Z. Wang, A. I. Zaromytidou, X. H. Zhang, L. F. Chow-Tsang, J. X. Liu, H. Kim, A. Barlas, K. Manova-Todorova, V. Kaartinen, L. Studer, W. Mark, D. J. Patel, J. Massague
A Poised Chromatin Platform For Tgf-Beta Access To Master Regulators
Cell(Cambridge, Mass. ) V. 147 1511 2011
PubMed-ID: 22196728  |  Reference-DOI: 10.1016/J.CELL.2011.11.032

(-) Compounds

Molecule 1 - E3 UBIQUITIN-PROTEIN LIGASE TRIM33
    ChainsA, B, C, D, E, F, G, H, I, J, K, L
    EC Number6.3.2.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPRSFDUET-1
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentTHE C-TERMINAL PHD AND BROMO DUAL DOMAINS OF TRIM33, UNP RESIDUES 882-1087
    GeneTRIM33, KIAA1113, RFG7, TIF1G
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymECTODERMIN HOMOLOG, RET-FUSED GENE 7 PROTEIN, PROTEIN RFG7, TRANSCRIPTION INTERMEDIARY FACTOR 1-GAMMA, TIF1-GAMMA, TRIPARTITE MOTIF-CONTAINING PROTEIN 33

 Structural Features

(-) Chains, Units

  123456789101112
Asymmetric Unit ABCDEFGHIJKL
Biological Unit 1 (1x)A           
Biological Unit 2 (1x) B          
Biological Unit 3 (1x)  C         
Biological Unit 4 (1x)   D        
Biological Unit 5 (1x)    E       
Biological Unit 6 (1x)     F      
Biological Unit 7 (1x)      G     
Biological Unit 8 (1x)       H    
Biological Unit 9 (1x)        I   
Biological Unit 10 (1x)         J  
Biological Unit 11 (1x)          K 
Biological Unit 12 (1x)           L

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 36)

Asymmetric Unit (2, 36)
No.NameCountTypeFull Name
1CA12Ligand/IonCALCIUM ION
2ZN24Ligand/IonZINC ION
Biological Unit 1 (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2ZN-1Ligand/IonZINC ION
Biological Unit 2 (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2ZN-1Ligand/IonZINC ION
Biological Unit 3 (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2ZN-1Ligand/IonZINC ION
Biological Unit 4 (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2ZN-1Ligand/IonZINC ION
Biological Unit 5 (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2ZN-1Ligand/IonZINC ION
Biological Unit 6 (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2ZN-1Ligand/IonZINC ION
Biological Unit 7 (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2ZN-1Ligand/IonZINC ION
Biological Unit 8 (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2ZN-1Ligand/IonZINC ION
Biological Unit 9 (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2ZN-1Ligand/IonZINC ION
Biological Unit 10 (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2ZN-1Ligand/IonZINC ION
Biological Unit 11 (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2ZN-1Ligand/IonZINC ION
Biological Unit 12 (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2ZN-1Ligand/IonZINC ION

(-) Sites  (36, 36)

Asymmetric Unit (36, 36)
No.NameEvidenceResiduesDescription
01AC1SOFTWARECYS A:890 , CYS A:893 , HIS A:910 , CYS A:913BINDING SITE FOR RESIDUE ZN A 1
02AC2SOFTWARECYS A:902 , CYS A:905 , CYS A:928 , CYS A:931BINDING SITE FOR RESIDUE ZN A 2
03AC3SOFTWAREASP A:1022 , ASP J:898BINDING SITE FOR RESIDUE CA A 3
04AC4SOFTWARECYS B:890 , CYS B:893 , HIS B:910 , CYS B:913BINDING SITE FOR RESIDUE ZN B 1
05AC5SOFTWARECYS B:902 , CYS B:905 , CYS B:928 , CYS B:931BINDING SITE FOR RESIDUE ZN B 2
06AC6SOFTWAREASP B:1022 , ASP K:898BINDING SITE FOR RESIDUE CA B 3
07AC7SOFTWARECYS C:890 , CYS C:893 , HIS C:910 , CYS C:913BINDING SITE FOR RESIDUE ZN C 1
08AC8SOFTWARECYS C:902 , CYS C:905 , CYS C:928 , CYS C:931BINDING SITE FOR RESIDUE ZN C 2
09AC9SOFTWAREASP C:1022 , ASP D:898BINDING SITE FOR RESIDUE CA C 3
10BC1SOFTWARECYS D:890 , CYS D:893 , HIS D:910 , CYS D:913BINDING SITE FOR RESIDUE ZN D 1
11BC2SOFTWARECYS D:902 , CYS D:905 , CYS D:928 , CYS D:931BINDING SITE FOR RESIDUE ZN D 2
12BC3SOFTWAREASP D:1022 , ASP E:898BINDING SITE FOR RESIDUE CA E 3
13BC4SOFTWARECYS E:890 , CYS E:893 , HIS E:910 , CYS E:913BINDING SITE FOR RESIDUE ZN E 1
14BC5SOFTWARECYS E:902 , CYS E:905 , CYS E:928 , CYS E:931BINDING SITE FOR RESIDUE ZN E 2
15BC6SOFTWAREASP E:1022 , ASP G:898BINDING SITE FOR RESIDUE CA E 1088
16BC7SOFTWARECYS F:890 , CYS F:893 , HIS F:910 , CYS F:913BINDING SITE FOR RESIDUE ZN F 1
17BC8SOFTWARECYS F:902 , CYS F:905 , CYS F:928 , CYS F:931BINDING SITE FOR RESIDUE ZN F 2
18BC9SOFTWAREASP F:1022 , ASP H:898BINDING SITE FOR RESIDUE CA F 3
19CC1SOFTWARECYS G:890 , CYS G:893 , HIS G:910 , CYS G:913BINDING SITE FOR RESIDUE ZN G 1
20CC2SOFTWARECYS G:902 , CYS G:905 , CYS G:928 , CYS G:931BINDING SITE FOR RESIDUE ZN G 2
21CC3SOFTWAREASP F:898 , ASP G:1022BINDING SITE FOR RESIDUE CA F 1088
22CC4SOFTWARECYS H:890 , CYS H:893 , HIS H:910 , CYS H:913BINDING SITE FOR RESIDUE ZN H 1
23CC5SOFTWARECYS H:902 , CYS H:905 , CYS H:928 , CYS H:931BINDING SITE FOR RESIDUE ZN H 2
24CC6SOFTWAREASP C:898 , ASP H:1022BINDING SITE FOR RESIDUE CA C 1088
25CC7SOFTWARECYS I:890 , CYS I:893 , HIS I:910 , CYS I:913BINDING SITE FOR RESIDUE ZN I 1
26CC8SOFTWARECYS I:902 , CYS I:905 , CYS I:928 , CYS I:931BINDING SITE FOR RESIDUE ZN I 2
27CC9SOFTWAREASP I:1022 , ASP L:898BINDING SITE FOR RESIDUE CA I 3
28DC1SOFTWARECYS J:890 , CYS J:893 , HIS J:910 , CYS J:913BINDING SITE FOR RESIDUE ZN J 1
29DC2SOFTWARECYS J:902 , CYS J:905 , CYS J:928 , CYS J:931BINDING SITE FOR RESIDUE ZN J 2
30DC3SOFTWAREASP B:898 , ASP J:1022BINDING SITE FOR RESIDUE CA B 1088
31DC4SOFTWARECYS K:890 , CYS K:893 , HIS K:910 , CYS K:913BINDING SITE FOR RESIDUE ZN K 1
32DC5SOFTWARECYS K:902 , CYS K:905 , CYS K:928 , CYS K:931BINDING SITE FOR RESIDUE ZN K 2
33DC6SOFTWAREASP I:898 , ASP K:1022BINDING SITE FOR RESIDUE CA I 1088
34DC7SOFTWARECYS L:890 , CYS L:893 , HIS L:910 , CYS L:913BINDING SITE FOR RESIDUE ZN L 1
35DC8SOFTWARECYS L:902 , CYS L:905 , CYS L:928 , CYS L:931BINDING SITE FOR RESIDUE ZN L 2
36DC9SOFTWAREASP A:898 , ASP L:1022BINDING SITE FOR RESIDUE CA A 1088

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3U5M)

(-) Cis Peptide Bonds  (12, 12)

Asymmetric Unit
No.Residues
1Val A:915 -Pro A:916
2Val B:915 -Pro B:916
3Val C:915 -Pro C:916
4Val D:915 -Pro D:916
5Val E:915 -Pro E:916
6Val F:915 -Pro F:916
7Val G:915 -Pro G:916
8Val H:915 -Pro H:916
9Val I:915 -Pro I:916
10Val J:915 -Pro J:916
11Val K:915 -Pro K:916
12Val L:915 -Pro L:916

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 20)

Asymmetric Unit (2, 20)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042379P885STRI33_HUMANUnclassified  ---A/B/C/D/E/G/J/KP885S
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622A/B/C/D/E/F/G/H/I/J/K/LV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042379P885STRI33_HUMANUnclassified  ---AP885S
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622AV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042379P885STRI33_HUMANUnclassified  ---BP885S
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622BV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042379P885STRI33_HUMANUnclassified  ---CP885S
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622CV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042379P885STRI33_HUMANUnclassified  ---DP885S
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622DV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 5 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042379P885STRI33_HUMANUnclassified  ---EP885S
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622EV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 6 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622FV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 7 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042379P885STRI33_HUMANUnclassified  ---GP885S
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622GV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 8 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622HV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 9 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622IV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 10 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042379P885STRI33_HUMANUnclassified  ---JP885S
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622JV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 11 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_042379P885STRI33_HUMANUnclassified  ---KP885S
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622KV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 12 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
2UniProtVAR_042380V961MTRI33_HUMANPolymorphism55688622LV961M

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 36)

Asymmetric Unit (3, 36)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
 
 
 
 
  12A:887-934
B:887-934
C:887-934
D:887-934
E:887-934
F:887-934
G:887-934
H:887-934
I:887-934
J:887-934
K:887-934
L:887-934
2ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
 
 
 
 
  12A:890-931
B:890-931
C:890-931
D:890-931
E:890-931
F:890-931
G:890-931
H:890-931
I:890-931
J:890-931
K:890-931
L:890-931
3BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
 
 
 
 
  12A:974-1046
B:974-1046
C:974-1046
D:974-1046
E:974-1046
F:974-1046
G:974-1046
H:974-1046
I:974-1046
J:974-1046
K:974-1046
L:974-1046
Biological Unit 1 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
 
 
 
 
  1A:887-934
-
-
-
-
-
-
-
-
-
-
-
2ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
 
 
 
 
  1A:890-931
-
-
-
-
-
-
-
-
-
-
-
3BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
 
 
 
 
  1A:974-1046
-
-
-
-
-
-
-
-
-
-
-
Biological Unit 2 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
 
 
 
 
  1-
B:887-934
-
-
-
-
-
-
-
-
-
-
2ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
 
 
 
 
  1-
B:890-931
-
-
-
-
-
-
-
-
-
-
3BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
 
 
 
 
  1-
B:974-1046
-
-
-
-
-
-
-
-
-
-
Biological Unit 3 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
 
 
 
 
  1-
-
C:887-934
-
-
-
-
-
-
-
-
-
2ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
 
 
 
 
  1-
-
C:890-931
-
-
-
-
-
-
-
-
-
3BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
 
 
 
 
  1-
-
C:974-1046
-
-
-
-
-
-
-
-
-
Biological Unit 4 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
D:887-934
-
-
-
-
-
-
-
-
2ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
D:890-931
-
-
-
-
-
-
-
-
3BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
D:974-1046
-
-
-
-
-
-
-
-
Biological Unit 5 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
E:887-934
-
-
-
-
-
-
-
2ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
E:890-931
-
-
-
-
-
-
-
3BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
E:974-1046
-
-
-
-
-
-
-
Biological Unit 6 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
F:887-934
-
-
-
-
-
-
2ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
F:890-931
-
-
-
-
-
-
3BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
F:974-1046
-
-
-
-
-
-
Biological Unit 7 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
G:887-934
-
-
-
-
-
2ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
G:890-931
-
-
-
-
-
3BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
G:974-1046
-
-
-
-
-
Biological Unit 8 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
H:887-934
-
-
-
-
2ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
H:890-931
-
-
-
-
3BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
H:974-1046
-
-
-
-
Biological Unit 9 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
I:887-934
-
-
-
2ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
I:890-931
-
-
-
3BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
I:974-1046
-
-
-
Biological Unit 10 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
J:887-934
-
-
2ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
J:890-931
-
-
3BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
J:974-1046
-
-
Biological Unit 11 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
K:887-934
-
2ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
K:890-931
-
3BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
K:974-1046
-
Biological Unit 12 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ZF_PHD_2PS50016 Zinc finger PHD-type profile.TRI33_HUMAN887-934
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
L:887-934
2ZF_PHD_1PS01359 Zinc finger PHD-type signature.TRI33_HUMAN890-931
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
L:890-931
3BROMODOMAIN_2PS50014 Bromodomain profile.TRI33_HUMAN974-1046
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
L:974-1046

(-) Exons   (0, 0)

(no "Exon" information available for 3U5M)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:178
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:203
                                   894       904       914       924       934       944       954       964       974       984       994      1004      1014      1024      1034      1044      1054      1064      1074      1084   
         TRI33_HUMAN    885 PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............ee......ee..................................------------...hhhhhhhhhhhhhhhhhh.hhhhhh........hhhhhh....hhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhh.-------------.hhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) S---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --ZF_PHD_2  PDB: A:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: A:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) -----ZF_PHD_1  PDB: A:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3u5m A  885 PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDC------------QGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQ-------------SEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   894       904       914       924       934        |-         - |     964       974       984       994      1004      1014      1024      1034      1044 |       -     |1064      1074      1084   
                                                                                    943          956                                                                                      1046          1060                           

Chain B from PDB  Type:PROTEIN  Length:178
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:203
                                   894       904       914       924       934       944       954       964       974       984       994      1004      1014      1024      1034      1044      1054      1064      1074      1084   
         TRI33_HUMAN    885 PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............ee......ee.................................------------....hhhhhhhhhhhhhhhhhh.hhhhhh........hhhhhh....hhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhh...-------------.hhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) S---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --ZF_PHD_2  PDB: B:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: B:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) -----ZF_PHD_1  PDB: B:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3u5m B  885 PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYD------------AQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQ-------------SEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   894       904       914       924       934       | -         -|      964       974       984       994      1004      1014      1024      1034      1044 |       -     |1064      1074      1084   
                                                                                   942          955                                                                                       1046          1060                           

Chain C from PDB  Type:PROTEIN  Length:174
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:203
                                   894       904       914       924       934       944       954       964       974       984       994      1004      1014      1024      1034      1044      1054      1064      1074      1084   
         TRI33_HUMAN    885 PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eee......ee..............................---------------....hhhhhhhhhhhhhhhhhh.hhhhhh........hhhhhh....hhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhh-...-------------.hhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) S---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --ZF_PHD_2  PDB: C:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: C:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) -----ZF_PHD_1  PDB: C:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3u5m C  885 PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEV---------------AQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMM-VVQ-------------SEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   894       904       914       924       934    |    -         -|      964       974       984       994      1004      1014      1024      1034      1044 |       -     |1064      1074      1084   
                                                                                939             955                                                                                   1042 | |          1060                           
                                                                                                                                                                                        1044 |                                         
                                                                                                                                                                                          1046                                         

Chain D from PDB  Type:PROTEIN  Length:177
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:203
                                   894       904       914       924       934       944       954       964       974       984       994      1004      1014      1024      1034      1044      1054      1064      1074      1084   
         TRI33_HUMAN    885 PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............ee......ee.................................-------------...hhhhhhhhhhhhhhhhhh.hhhhhh........hhhhhh....hhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhh...-------------.hhhhhhhhhhhhhhhhhhhhh..ee.. Sec.struct. author
                 SAPs(SNPs) S---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --ZF_PHD_2  PDB: D:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: D:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) -----ZF_PHD_1  PDB: D:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3u5m D  885 PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYD-------------QGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQ-------------SEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   894       904       914       924       934       | -         - |     964       974       984       994      1004      1014      1024      1034      1044 |       -     |1064      1074      1084   
                                                                                   942           956                                                                                      1046          1060                           

Chain E from PDB  Type:PROTEIN  Length:173
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:203
                                   894       904       914       924       934       944       954       964       974       984       994      1004      1014      1024      1034      1044      1054      1064      1074      1084   
         TRI33_HUMAN    885 PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eee......ee.............................-----------------...hhhhhhhhhhhhhhhhhh.hhhhhh........hhhhhh....hhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhh.-------------.hhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) S---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --ZF_PHD_2  PDB: E:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: E:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) -----ZF_PHD_1  PDB: E:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3u5m E  885 PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPE-----------------QGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQ-------------SEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   894       904       914       924       934   |     -         - |     964       974       984       994      1004      1014      1024      1034      1044 |       -     |1064      1074      1084   
                                                                               938               956                                                                                      1046          1060                           

Chain F from PDB  Type:PROTEIN  Length:179
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:202
                                   895       905       915       925       935       945       955       965       975       985       995      1005      1015      1025      1035      1045      1055      1065      1075      1085  
         TRI33_HUMAN    886 NEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............ee......ee..................................-----------....hhhhhhhhhhhhhhhhhh.hhhhhh........hhhhhh....hhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhh..------------..hhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -ZF_PHD_2  PDB: F:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: F:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) ----ZF_PHD_1  PDB: F:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3u5m F  886 NEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDC-----------AQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQ------------DSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   895       905       915       925       935       | -       955       965       975       985       995      1005      1015      1025      1035      1045|        -   |  1065      1075      1085  
                                                                                   943         955                                                                                       1046         1059                            

Chain G from PDB  Type:PROTEIN  Length:180
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:203
                                   894       904       914       924       934       944       954       964       974       984       994      1004      1014      1024      1034      1044      1054      1064      1074      1084   
         TRI33_HUMAN    885 PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............ee......ee..................................-----------....hhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhh....hhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhh...------------..hhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) S---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --ZF_PHD_2  PDB: G:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: G:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) -----ZF_PHD_1  PDB: G:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3u5m G  885 PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDC-----------AQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQ------------DSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   894       904       914       924       934        |-         -|      964       974       984       994      1004      1014      1024      1034      1044 |       -    | 1064      1074      1084   
                                                                                    943         955                                                                                       1046         1059                            

Chain H from PDB  Type:PROTEIN  Length:178
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:202
                                   895       905       915       925       935       945       955       965       975       985       995      1005      1015      1025      1035      1045      1055      1065      1075      1085  
         TRI33_HUMAN    886 NEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............ee......ee..................................-----------....hhhhhhhhhhhhhhhhh..hhhhhh........hhhhhh....hhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhh....-------------.hhhhhhhhhhhhhhhhhhhhh..ee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -ZF_PHD_2  PDB: H:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: H:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) ----ZF_PHD_1  PDB: H:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3u5m H  886 NEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDC-----------AQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQ-------------SEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   895       905       915       925       935       | -       955       965       975       985       995      1005      1015      1025      1035      1045|        -    | 1065      1075      1085  
                                                                                   943         955                                                                                       1046          1060                           

Chain I from PDB  Type:PROTEIN  Length:173
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:202
                                   895       905       915       925       935       945       955       965       975       985       995      1005      1015      1025      1035      1045      1055      1065      1075      1085  
         TRI33_HUMAN    886 NEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............ee......ee.............................----------------....hhhhhhhhhhhhhhhhhh.hhhhhh........hhhhhh....hhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhh...-------------..hhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -ZF_PHD_2  PDB: I:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: I:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) ----ZF_PHD_1  PDB: I:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3u5m I  886 NEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPE----------------AQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQ-------------SEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   895       905       915       925       935  |      -       955       965       975       985       995      1005      1015      1025      1035      1045|        -    | 1065      1075      1085  
                                                                              938              955                                                                                       1046          1060                           

Chain J from PDB  Type:PROTEIN  Length:174
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:203
                                   894       904       914       924       934       944       954       964       974       984       994      1004      1014      1024      1034      1044      1054      1064      1074      1084   
         TRI33_HUMAN    885 PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............ee......ee.............................----------------....hhhhhhhhhhhhhhhhhh.hhhhhh........hhhhhh....hhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhh...-------------.hhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) S---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --ZF_PHD_2  PDB: J:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: J:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) -----ZF_PHD_1  PDB: J:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3u5m J  885 PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPE----------------AQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQ-------------SEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   894       904       914       924       934   |     -         -|      964       974       984       994      1004      1014      1024      1034      1044 |       -     |1064      1074      1084   
                                                                               938              955                                                                                       1046          1060                           

Chain K from PDB  Type:PROTEIN  Length:175
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:203
                                   894       904       914       924       934       944       954       964       974       984       994      1004      1014      1024      1034      1044      1054      1064      1074      1084   
         TRI33_HUMAN    885 PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............ee......ee..............................---------------....hhhhhhhhhhhhhhhhhh.hhhhhh........hhhhhh....hhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhh...-------------.hhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) S---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --ZF_PHD_2  PDB: K:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: K:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) -----ZF_PHD_1  PDB: K:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3u5m K  885 PNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEV---------------AQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQ-------------SEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   894       904       914       924       934    |    -         -|      964       974       984       994      1004      1014      1024      1034      1044 |       -     |1064      1074      1084   
                                                                                939             955                                                                                       1046          1060                           

Chain L from PDB  Type:PROTEIN  Length:175
 aligned with TRI33_HUMAN | Q9UPN9 from UniProtKB/Swiss-Prot  Length:1127

    Alignment length:202
                                   895       905       915       925       935       945       955       965       975       985       995      1005      1015      1025      1035      1045      1055      1065      1075      1085  
         TRI33_HUMAN    886 NEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............ee......ee..............................---------------....hhhhhhhhhhhhhhhhhh.hhhhhh........hhhhhh....hhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhh.------------.hhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -ZF_PHD_2  PDB: L:887-934 UniProt: 887-934       ---------------------------------------BROMODOMAIN_2  PDB: L:974-1046 UniProt: 974-1046                         ----------------------------------------- PROSITE (1)
                PROSITE (2) ----ZF_PHD_1  PDB: L:890-931 UniProt: 890-931 ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3u5m L  886 NEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEV---------------AQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQ------------DSEVAQAGKAVALYFEDKLTEIYSDRTFA 1087
                                   895       905       915       925       935   |     -       955       965       975       985       995      1005      1015      1025      1035      1045|        -   |  1065      1075      1085  
                                                                               939             955                                                                                       1046         1059                            

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3U5M)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3U5M)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3U5M)

(-) Gene Ontology  (19, 19)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F,G,H,I,J,K,L   (TRI33_HUMAN | Q9UPN9)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0070412    R-SMAD binding    Interacting selectively and non-covalently with a receptor-regulated SMAD signaling protein.
    GO:0070410    co-SMAD binding    Interacting selectively and non-covalently with a common mediator SMAD signaling protein.
    GO:0016874    ligase activity    Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004842    ubiquitin-protein transferase activity    Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0030514    negative regulation of BMP signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of the BMP signaling pathway.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045892    negative regulation of transcription, DNA-templated    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0016567    protein ubiquitination    The process in which one or more ubiquitin groups are added to a protein.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0017015    regulation of transforming growth factor beta receptor signaling pathway    Any process that modulates the frequency, rate or extent of activity of any TGF-beta receptor signaling pathway.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
    DC2  [ RasMol ]  +environment [ RasMol ]
    DC3  [ RasMol ]  +environment [ RasMol ]
    DC4  [ RasMol ]  +environment [ RasMol ]
    DC5  [ RasMol ]  +environment [ RasMol ]
    DC6  [ RasMol ]  +environment [ RasMol ]
    DC7  [ RasMol ]  +environment [ RasMol ]
    DC8  [ RasMol ]  +environment [ RasMol ]
    DC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Val A:915 - Pro A:916   [ RasMol ]  
    Val B:915 - Pro B:916   [ RasMol ]  
    Val C:915 - Pro C:916   [ RasMol ]  
    Val D:915 - Pro D:916   [ RasMol ]  
    Val E:915 - Pro E:916   [ RasMol ]  
    Val F:915 - Pro F:916   [ RasMol ]  
    Val G:915 - Pro G:916   [ RasMol ]  
    Val H:915 - Pro H:916   [ RasMol ]  
    Val I:915 - Pro I:916   [ RasMol ]  
    Val J:915 - Pro J:916   [ RasMol ]  
    Val K:915 - Pro K:916   [ RasMol ]  
    Val L:915 - Pro L:916   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]
    Biological Unit 7  [ Jena3D ]
    Biological Unit 8  [ Jena3D ]
    Biological Unit 9  [ Jena3D ]
    Biological Unit 10  [ Jena3D ]
    Biological Unit 11  [ Jena3D ]
    Biological Unit 12  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3u5m
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TRI33_HUMAN | Q9UPN9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  6.3.2.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TRI33_HUMAN | Q9UPN9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TRI33_HUMAN | Q9UPN93u5n 3u5o 3u5p

(-) Related Entries Specified in the PDB File

3u5n 3u5o 3u5p