Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  EB1C/EB3C HETERODIMER IN COMPLEX WITH THE CAP-GLY DOMAIN OF P150GLUED
 
Authors :  C. O. De Groot, M. A. Scharer, G. Capitani, M. O. Steinmetz
Date :  09 Sep 11  (Deposition) - 25 Jan 12  (Release) - 25 Jan 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A,B,P,Q
Keywords :  Cap-Gly Domain, Protein-Protein Interaction, Microtubule Binding, Cytoskeleton, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Bjelic, C. O. De Groot, M. A. Scharer, R. Jaussi, K. Bargsten, M. Salzmann, D. Frey, G. Capitani, R. A. Kammerer, M. O. Steinmetz
Interaction Of Mammalian End Binding Proteins With Cap-Gly Domains Of Clip-170 And P150(Glued).
J. Struct. Biol. V. 177 160 2012
PubMed-ID: 22119847  |  Reference-DOI: 10.1016/J.JSB.2011.11.010

(-) Compounds

Molecule 1 - MICROTUBULE-ASSOCIATED PROTEIN RP/EB FAMILY MEMBER 1
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET15B
    Expression System StrainBL21 (DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentEB1 C-TERMINAL DOMAIN
    GeneMAPRE1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymAPC-BINDING PROTEIN EB1, END-BINDING PROTEIN 1, EB1
 
Molecule 2 - MICROTUBULE-ASSOCIATED PROTEIN RP/EB FAMILY MEMBER 3
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPDEST17
    Expression System StrainBL21 (DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentEB3 C-TERMINAL DOMAIN
    GeneMAPRE3
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymEB1 PROTEIN FAMILY MEMBER 3, EBF3, END-BINDING PROTEIN 3, EB3, RP3
 
Molecule 3 - DYNACTIN SUBUNIT 1
    ChainsP, Q
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET15B
    Expression System StrainBL21 (DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentCAP-GLY DOMAIN OF P150GLUED
    GeneDCTN1
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Synonym150 KDA DYNEIN-ASSOCIATED POLYPEPTIDE, DAP-150, DP-150, P135, P150-GLUED

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABPQ

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3TQ7)

(-) Sites  (0, 0)

(no "Site" information available for 3TQ7)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3TQ7)

(-) Cis Peptide Bonds  (5, 5)

Asymmetric/Biological Unit
No.Residues
1Asp A:250 -Glu A:251
2Gln A:265 -Glu A:266
3Thr B:258 -Glu B:259
4Ile P:36 -Gly P:37
5Ile Q:36 -Gly Q:37

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (8, 16)

Asymmetric/Biological Unit (8, 16)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_071452F52LDCTN1_HUMANDisease (PERRYS)  ---P/QF52L
2UniProtVAR_015850G59SDCTN1_HUMANDisease (HMN7B)121909342P/QG59S
3UniProtVAR_063867G71ADCTN1_HUMANDisease (PERRYS)67586389P/QG71A
4UniProtVAR_063868G71EDCTN1_HUMANDisease (PERRYS)67586389P/QG71E
5UniProtVAR_063869G71RDCTN1_HUMANDisease (PERRYS)72466485P/QG71R
6UniProtVAR_063870T72PDCTN1_HUMANDisease (PERRYS)72466486P/QT72P
7UniProtVAR_063871Q74PDCTN1_HUMANDisease (PERRYS)72466487P/QQ74P
8UniProtVAR_071453Y78CDCTN1_HUMANDisease (PERRYS)  ---P/QY78C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 4)

Asymmetric/Biological Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CAP_GLY_1PS00845 CAP-Gly domain signature.DCTN1_HUMAN48-79
 
  2P:48-79
Q:48-79
2CAP_GLY_2PS50245 CAP-Gly domain profile.DCTN1_HUMAN48-90
 
  2P:48-90
Q:48-90

(-) Exons   (8, 10)

Asymmetric/Biological Unit (8, 10)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002331211aENSE00001872228chr2:27193480-27193670191MARE3_HUMAN-00--
1.5aENST000002331215aENSE00002189996chr2:27245080-27245207128MARE3_HUMAN1-41410--
1.7aENST000002331217aENSE00000731657chr2:27246200-27246345146MARE3_HUMAN41-89490--
1.7fENST000002331217fENSE00000731724chr2:27246964-27247165202MARE3_HUMAN90-157680--
1.8ENST000002331218ENSE00000731725chr2:27248451-27248605155MARE3_HUMAN157-208521B:204-2085
1.9bENST000002331219bENSE00000809043chr2:27248748-27248900153MARE3_HUMAN209-259511B:209-259 (gaps)51
1.10bENST0000023312110bENSE00001136297chr2:27249148-27250064917MARE3_HUMAN260-281221B:278-2814

2.7aENST000003618747aENSE00001940242chr2:74607482-74607132351DCTN1_HUMAN1-11110--
2.9dENST000003618749dENSE00001606774chr2:74605372-74605127246DCTN1_HUMAN12-93822P:27-93
Q:27-93
67
67
2.10bENST0000036187410bENSE00000762538chr2:74604853-7460477579DCTN1_HUMAN94-120272P:94-97
Q:94-97
4
4
2.11aENST0000036187411aENSE00002160083chr2:74604593-7460455935DCTN1_HUMAN120-131120--
2.13aENST0000036187413aENSE00001408363chr2:74603889-7460386921DCTN1_HUMAN132-13870--
2.14cENST0000036187414cENSE00001744349chr2:74601467-7460145018DCTN1_HUMAN139-14460--
2.16cENST0000036187416cENSE00001426050chr2:74600075-7460005521DCTN1_HUMAN145-15170--
2.17eENST0000036187417eENSE00001261719chr2:74598855-74598664192DCTN1_HUMAN152-215640--
2.17hENST0000036187417hENSE00001261373chr2:74598303-74598106198DCTN1_HUMAN216-281660--
2.18ENST0000036187418ENSE00000762534chr2:74597952-74597748205DCTN1_HUMAN282-350690--
2.19ENST0000036187419ENSE00001261359chr2:74597671-7459759379DCTN1_HUMAN350-376270--
2.20ENST0000036187420ENSE00001261354chr2:74597472-74597313160DCTN1_HUMAN376-429540--
2.21ENST0000036187421ENSE00000762531chr2:74597196-74597092105DCTN1_HUMAN430-464350--
2.22aENST0000036187422aENSE00001261342chr2:74596618-74596427192DCTN1_HUMAN465-528640--
2.23ENST0000036187423ENSE00001261333chr2:74596341-74596225117DCTN1_HUMAN529-567390--
2.24aENST0000036187424aENSE00000762527chr2:74596007-74595855153DCTN1_HUMAN568-618510--
2.24cENST0000036187424cENSE00001261323chr2:74595258-74595098161DCTN1_HUMAN619-672540--
2.25ENST0000036187425ENSE00001694213chr2:74594991-74594823169DCTN1_HUMAN672-728570--
2.26ENST0000036187426ENSE00001758208chr2:74594547-7459447969DCTN1_HUMAN729-751230--
2.27ENST0000036187427ENSE00001726995chr2:74594234-7459417263DCTN1_HUMAN752-772210--
2.28aENST0000036187428aENSE00001199793chr2:74594059-74593910150DCTN1_HUMAN773-822500--
2.28cENST0000036187428cENSE00001199788chr2:74593747-74593586162DCTN1_HUMAN823-876540--
2.28fENST0000036187428fENSE00001777917chr2:74593502-74593371132DCTN1_HUMAN877-920440--
2.29cENST0000036187429cENSE00001714582chr2:74593145-74593020126DCTN1_HUMAN921-962420--
2.30aENST0000036187430aENSE00001805744chr2:74592784-74592642143DCTN1_HUMAN963-1010480--
2.30eENST0000036187430eENSE00001635537chr2:74592368-74592202167DCTN1_HUMAN1010-1066570--
2.31bENST0000036187431bENSE00001749721chr2:74590755-7459074115DCTN1_HUMAN1066-107160--
2.31cENST0000036187431cENSE00001714864chr2:74590554-74590421134DCTN1_HUMAN1071-1115450--
2.32ENST0000036187432ENSE00001616375chr2:74590304-74590121184DCTN1_HUMAN1116-1177620--
2.33bENST0000036187433bENSE00001641035chr2:74589856-7458977780DCTN1_HUMAN1177-1203270--
2.34aENST0000036187434aENSE00001788775chr2:74589268-7458917990DCTN1_HUMAN1204-1233300--
2.35gENST0000036187435gENSE00001902273chr2:74588763-74588281483DCTN1_HUMAN1234-1278450--

3.1ENST000003755711ENSE00001467575chr20:31407699-31407834136MARE1_HUMAN-00--
3.2aENST000003755712aENSE00001467571chr20:31413731-31413854124MARE1_HUMAN1-41410--
3.3aENST000003755713aENSE00000661239chr20:31421523-31421668146MARE1_HUMAN41-89490--
3.4ENST000003755714ENSE00000661240chr20:31424440-31424647208MARE1_HUMAN90-159700--
3.5ENST000003755715ENSE00000661241chr20:31427541-31427662122MARE1_HUMAN159-199411A:197-1993
3.6ENST000003755716ENSE00000661242chr20:31434424-31434576153MARE1_HUMAN200-250511A:200-250 (gaps)51
3.7bENST000003755717bENSE00001950425chr20:31436478-314382111734MARE1_HUMAN251-268181A:251-268 (gaps)18

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:55
 aligned with MARE1_HUMAN | Q15691 from UniProtKB/Swiss-Prot  Length:268

    Alignment length:72
                                   206       216       226       236       246       256       266  
          MARE1_HUMAN   197 MQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY 268
               SCOP domains d3tq7a_ A:                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..----.hhhhhhhhhh....-------------.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------ PROSITE
               Transcript 3 3.5Exon 3.6  PDB: A:200-250 (gaps) UniProt: 200-250   Exon 3.7b          Transcript 3
                 3tq7 A 197 MQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENE----PVLQRIVDILYATDE-------------QEEY 268
                                   206       216       226     |   -|      246    |    -       266  
                                                             232  237           251           265   

Chain B from PDB  Type:PROTEIN  Length:55
 aligned with MARE3_HUMAN | Q9UPY8 from UniProtKB/Swiss-Prot  Length:281

    Alignment length:78
                                   213       223       233       243       253       263       273        
          MARE3_HUMAN   204 ELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY 281
               SCOP domains d3tq7b_ B: automated matches                                                   SCOP domains
               CATH domains ------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.-----.hhhhhhhhhh...------------------..ee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------ PROSITE
               Transcript 1 1.8  Exon 1.9b  PDB: B:209-259 (gaps) UniProt: 209-259  Exon 1.10b             Transcript 1
                 3tq7 B 204 ELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEH-----PVISGIIGILYATE------------------QDEY 281
                                   213       223       233      |  -  |    253     |   -         -    |   
                                                              240   246          259                278   

Chain P from PDB  Type:PROTEIN  Length:71
 aligned with DCTN1_HUMAN | Q14203 from UniProtKB/Swiss-Prot  Length:1278

    Alignment length:71
                                    36        46        56        66        76        86        96 
          DCTN1_HUMAN    27 LRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF  97
               SCOP domains d3tq7p_ P: Dynactin 1                                                   SCOP domains
               CATH domains ----------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee.....eeeeeeee........eeeeee.........ee..ee........eeee....eee. Sec.struct. author
             SAPs(SNPs) (1) -------------------------L------S-----------AP-P---C------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------E-------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------------------------------------------R-------------------------- SAPs(SNPs) (3)
                PROSITE (1) ---------------------CAP_GLY_1  PDB: P:48-79         ------------------ PROSITE (1)
                PROSITE (2) ---------------------CAP_GLY_2  PDB: P:48-90 UniProt: 48-90     ------- PROSITE (2)
               Transcript 2 Exon 2.9d  PDB: P:27-93 UniProt: 12-93 [INCOMPLETE]                2.10 Transcript 2
                 3tq7 P  27 LRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF  97
                                    36        46        56        66        76        86        96 

Chain Q from PDB  Type:PROTEIN  Length:71
 aligned with DCTN1_HUMAN | Q14203 from UniProtKB/Swiss-Prot  Length:1278

    Alignment length:71
                                    36        46        56        66        76        86        96 
          DCTN1_HUMAN    27 LRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF  97
               SCOP domains d3tq7q_ Q: Dynactin 1                                                   SCOP domains
               CATH domains ----------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee.....eeeeeeee........eeeeee.........ee..ee........eeeehhh.eee. Sec.struct. author
             SAPs(SNPs) (1) -------------------------L------S-----------AP-P---C------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------------E-------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------------------------------------------R-------------------------- SAPs(SNPs) (3)
                PROSITE (1) ---------------------CAP_GLY_1  PDB: Q:48-79         ------------------ PROSITE (1)
                PROSITE (2) ---------------------CAP_GLY_2  PDB: Q:48-90 UniProt: 48-90     ------- PROSITE (2)
               Transcript 2 Exon 2.9d  PDB: Q:27-93 UniProt: 12-93 [INCOMPLETE]                2.10 Transcript 2
                 3tq7 Q  27 LRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF  97
                                    36        46        56        66        76        86        96 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3TQ7)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3TQ7)

(-) Gene Ontology  (49, 68)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (MARE1_HUMAN | Q15691)
molecular function
    GO:0008017    microtubule binding    Interacting selectively and non-covalently with microtubules, filaments composed of tubulin monomers.
    GO:0051010    microtubule plus-end binding    Interacting selectively and non-covalently with the plus end of a microtubule.
    GO:0008022    protein C-terminus binding    Interacting selectively and non-covalently with a protein C-terminus, the end of any peptide chain at which the 1-carboxy function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0000086    G2/M transition of mitotic cell cycle    The mitotic cell cycle transition by which a cell in G2 commits to M phase. The process begins when the kinase activity of M cyclin/CDK complex reaches a threshold high enough for the cell cycle to proceed. This is accomplished by activating a positive feedback loop that results in the accumulation of unphosphorylated and active M cyclin/CDK complex.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0051301    cell division    The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:1904527    negative regulation of microtubule binding    Any process that stops, prevents or reduces the frequency, rate or extent of microtubule binding.
    GO:0031115    negative regulation of microtubule polymerization    Any process that stops, prevents, or reduces the frequency, rate or extent of microtubule polymerization.
    GO:0030335    positive regulation of cell migration    Any process that activates or increases the frequency, rate or extent of cell migration.
    GO:1903033    positive regulation of microtubule plus-end binding    Any process that activates or increases the frequency, rate or extent of microtubule plus-end binding.
    GO:0035372    protein localization to microtubule    A process in which a protein is transported to, or maintained at, a microtubule.
    GO:0007062    sister chromatid cohesion    The cell cycle process in which the sister chromatids of a replicated chromosome become tethered to each other.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0042995    cell projection    A prolongation or process extending from a cell, e.g. a flagellum or axon.
    GO:0031253    cell projection membrane    The portion of the plasma membrane surrounding a plasma membrane bounded cell surface projection.
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0030981    cortical microtubule cytoskeleton    The portion of the microtubule cytoskeleton that lies just beneath the plasma membrane.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005881    cytoplasmic microtubule    Any microtubule in the cytoplasm of a cell.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005874    microtubule    Any of the long, generally straight, hollow tubes of internal diameter 12-15 nm and external diameter 24 nm found in a wide variety of eukaryotic cells; each consists (usually) of 13 protofilaments of polymeric tubulin, staggered in such a manner that the tubulin monomers are arranged in a helical pattern on the microtubular surface, and with the alpha/beta axes of the tubulin subunits parallel to the long axis of the tubule; exist in equilibrium with pool of tubulin monomers and can be rapidly assembled or disassembled in response to physiological stimuli; concerned with force generation, e.g. in the spindle.
    GO:0015630    microtubule cytoskeleton    The part of the cytoskeleton (the internal framework of a cell) composed of microtubules and associated proteins.
    GO:0005815    microtubule organizing center    An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.
    GO:0035371    microtubule plus-end    The growing (plus) end of a microtubule. In vitro, microtubules polymerize more quickly at the plus end than at the minus end. In vivo, microtubule growth occurs only at the plus end, and the plus end switches between periods of growth and shortening, a behavior known as dynamic instability.
    GO:0005819    spindle    The array of microtubules and associated molecules that forms between opposite poles of a eukaryotic cell during mitosis or meiosis and serves to move the duplicated chromosomes apart.

Chain B   (MARE3_HUMAN | Q9UPY8)
molecular function
    GO:0008017    microtubule binding    Interacting selectively and non-covalently with microtubules, filaments composed of tubulin monomers.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0051301    cell division    The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
    GO:0045737    positive regulation of cyclin-dependent protein serine/threonine kinase activity    Any process that activates or increases the frequency, rate or extent of CDK activity.
    GO:1903033    positive regulation of microtubule plus-end binding    Any process that activates or increases the frequency, rate or extent of microtubule plus-end binding.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005881    cytoplasmic microtubule    Any microtubule in the cytoplasm of a cell.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005874    microtubule    Any of the long, generally straight, hollow tubes of internal diameter 12-15 nm and external diameter 24 nm found in a wide variety of eukaryotic cells; each consists (usually) of 13 protofilaments of polymeric tubulin, staggered in such a manner that the tubulin monomers are arranged in a helical pattern on the microtubular surface, and with the alpha/beta axes of the tubulin subunits parallel to the long axis of the tubule; exist in equilibrium with pool of tubulin monomers and can be rapidly assembled or disassembled in response to physiological stimuli; concerned with force generation, e.g. in the spindle.
    GO:0015630    microtubule cytoskeleton    The part of the cytoskeleton (the internal framework of a cell) composed of microtubules and associated proteins.
    GO:0035371    microtubule plus-end    The growing (plus) end of a microtubule. In vitro, microtubules polymerize more quickly at the plus end than at the minus end. In vivo, microtubule growth occurs only at the plus end, and the plus end switches between periods of growth and shortening, a behavior known as dynamic instability.
    GO:0030496    midbody    A thin cytoplasmic bridge formed between daughter cells at the end of cytokinesis. The midbody forms where the contractile ring constricts, and may persist for some time before finally breaking to complete cytokinesis.
    GO:0048471    perinuclear region of cytoplasm    Cytoplasm situated near, or occurring around, the nucleus.

Chain P,Q   (DCTN1_HUMAN | Q14203)
molecular function
    GO:0003774    motor activity    Catalysis of the generation of force resulting either in movement along a microfilament or microtubule, or in torque resulting in membrane scission, coupled to the hydrolysis of a nucleoside triphosphate.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006888    ER to Golgi vesicle-mediated transport    The directed movement of substances from the endoplasmic reticulum (ER) to the Golgi, mediated by COP II vesicles. Small COP II coated vesicles form from the ER and then fuse directly with the cis-Golgi. Larger structures are transported along microtubules to the cis-Golgi.
    GO:0000086    G2/M transition of mitotic cell cycle    The mitotic cell cycle transition by which a cell in G2 commits to M phase. The process begins when the kinase activity of M cyclin/CDK complex reaches a threshold high enough for the cell cycle to proceed. This is accomplished by activating a positive feedback loop that results in the accumulation of unphosphorylated and active M cyclin/CDK complex.
    GO:0036498    IRE1-mediated unfolded protein response    A series of molecular signals mediated by the endoplasmic reticulum stress sensor IRE1 (Inositol-requiring transmembrane kinase/endonuclease). Begins with activation of IRE1 in response to endoplasmic reticulum (ER) stress, and ends with regulation of a downstream cellular process, e.g. transcription. One target of activated IRE1 is the transcription factor HAC1 in yeast, or XBP1 in mammals; IRE1 cleaves an intron of a mRNA coding for HAC1/XBP1 to generate an activated HAC1/XBP1 transcription factor, which controls the up regulation of UPR-related genes. At least in mammals, IRE1 can also signal through additional intracellular pathways including JNK and NF-kappaB.
    GO:0019886    antigen processing and presentation of exogenous peptide antigen via MHC class II    The process in which an antigen-presenting cell expresses a peptide antigen of exogenous origin on its cell surface in association with an MHC class II protein complex. The peptide antigen is typically, but not always, processed from a whole protein.
    GO:0032402    melanosome transport    The directed movement of melanosomes into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0007399    nervous system development    The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
    GO:0042147    retrograde transport, endosome to Golgi    The directed movement of membrane-bounded vesicles from endosomes back to the trans-Golgi network where they are recycled for further rounds of transport.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0010970    transport along microtubule    The movement of organelles or other particles from one location in the cell to another along microtubules, driven by motor activity.
cellular component
    GO:0031252    cell leading edge    The area of a motile cell closest to the direction of movement.
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005869    dynactin complex    A 20S multiprotein assembly of total mass about 1.2 MDa that activates dynein-based activity in vivo. A large structural component of the complex is an actin-like 40 nm filament composed of actin-related protein, to which other components attach.
    GO:0030286    dynein complex    Any of several large complexes that contain two or three dynein heavy chains and several light chains, and have microtubule motor activity.
    GO:0000776    kinetochore    A multisubunit complex that is located at the centromeric region of DNA and provides an attachment point for the spindle microtubules.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005874    microtubule    Any of the long, generally straight, hollow tubes of internal diameter 12-15 nm and external diameter 24 nm found in a wide variety of eukaryotic cells; each consists (usually) of 13 protofilaments of polymeric tubulin, staggered in such a manner that the tubulin monomers are arranged in a helical pattern on the microtubular surface, and with the alpha/beta axes of the tubulin subunits parallel to the long axis of the tubule; exist in equilibrium with pool of tubulin monomers and can be rapidly assembled or disassembled in response to physiological stimuli; concerned with force generation, e.g. in the spindle.
    GO:0005815    microtubule organizing center    An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
    GO:0030904    retromer complex    A conserved hetero-pentameric membrane-associated complex involved in retrograde transport from endosomes to the Golgi apparatus. The budding yeast retromer comprises Vps35p, Vps29p, Vps26p, Vps5p, and Vps17p. The mammalian complex shows slight variation in composition compared to yeast, and comprises SNX1 or SNX2, SNX5 or SNX6, VPS26A or VPS26B, VPS29, and VPS35.
    GO:0000922    spindle pole    Either of the ends of a spindle, where spindle microtubules are organized; usually contains a microtubule organizing center and accessory molecules, spindle microtubules and astral microtubules.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3tq7)
 
  Sites
(no "Sites" information available for 3tq7)
 
  Cis Peptide Bonds
    Asp A:250 - Glu A:251   [ RasMol ]  
    Gln A:265 - Glu A:266   [ RasMol ]  
    Ile P:36 - Gly P:37   [ RasMol ]  
    Ile Q:36 - Gly Q:37   [ RasMol ]  
    Thr B:258 - Glu B:259   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3tq7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DCTN1_HUMAN | Q14203
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  MARE1_HUMAN | Q15691
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  MARE3_HUMAN | Q9UPY8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  168605
    Disease InformationOMIM
  607641
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  DCTN1_HUMAN | Q14203
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  MARE1_HUMAN | Q15691
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  MARE3_HUMAN | Q9UPY8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DCTN1_HUMAN | Q142031txq 2coy 2hkn 2hkq 2hl3 2hl5 2hqh 3e2u
        MARE1_HUMAN | Q156911pa7 1txq 1ueg 1vka 1wu9 1yib 1yig 2hkq 2hl3 2hl5 2qjz 2r8u 3gjo 3mtu 3mud 4xa1 4xa3 4xa6 5jv3 5jvm 5jvp 5jvr 5jvs 5jvu 5jx1
        MARE3_HUMAN | Q9UPY81wyo 3co1 3jak 3jal 3jar

(-) Related Entries Specified in the PDB File

1wu9 CRYSTAL STRUCTURE OF THE C-TERMINAL DOMAIN OF THE END- BINDING PROTEIN 1 (EB1) - HOMODIMER STRUCTURE
2hkq CRYSTAL STRUCTURE OF THE C-TERMINAL DOMAIN OF HUMAN EB1 IN COMPLEX WITH THE CAP-GLY DOMAIN OF HUMAN DYNACTIN-1 (P150- GLUED)