Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  HUMAN CDC34 E2 IN COMPLEX WITH CC0651 INHIBITOR
 
Authors :  D. F. Ceccarelli, D. R. Webb, F. Sicheri
Date :  11 May 11  (Deposition) - 06 Jul 11  (Release) - 06 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Ubiquitin Conjugating Enzyme Domain, E2 Domain, Ligase-Ligase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. F. Ceccarelli, X. Tang, B. Pelletier, S. Orlicky, W. Xie, V. Plantevin, D. Neculai, Y. C. Chou, A. Ogunjimi, A. Al-Hakim, X. Varelas, J. Koszela, G. A. Wasney, M. Vedadi, S. Dhe-Paganon, S. Cox S. Xu, A. Lopez-Girona, F. Mercurio, J. Wrana, D. Durocher, S. Meloche D. R. Webb, M. Tyers, F. Sicheri
An Allosteric Inhibitor Of The Human Cdc34 Ubiquitin Conjugating Enzyme
Cell(Cambridge, Mass. ) V. 145 1075 2011
PubMed-ID: 21683433  |  Reference-DOI: 10.1016/J.CELL.2011.05.039

(-) Compounds

Molecule 1 - UBIQUITIN-CONJUGATING ENZYME E2 R1
    ChainsA, B, C, D
    EC Number6.3.2.19
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentUNP RESIDUES 7-184
    GeneCDC34, UBCH3, UBE2R1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymUBIQUITIN-CONJUGATING ENZYME E2-32 KDA COMPLEMENTING, UBIQUITIN-CONJUGATING ENZYME E2-CDC34, UBIQUITIN-PROTEIN LIGASE R1

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A   
Biological Unit 2 (1x) B  
Biological Unit 3 (1x)  C 
Biological Unit 4 (1x)   D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1U944Ligand/Ion4,5-DIDEOXY-5-(3',5'-DICHLOROBIPHENYL-4-YL)-4-[(METHOXYACETYL)AMINO]-L-ARABINONIC ACID
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1U941Ligand/Ion4,5-DIDEOXY-5-(3',5'-DICHLOROBIPHENYL-4-YL)-4-[(METHOXYACETYL)AMINO]-L-ARABINONIC ACID
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1U941Ligand/Ion4,5-DIDEOXY-5-(3',5'-DICHLOROBIPHENYL-4-YL)-4-[(METHOXYACETYL)AMINO]-L-ARABINONIC ACID
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
1U941Ligand/Ion4,5-DIDEOXY-5-(3',5'-DICHLOROBIPHENYL-4-YL)-4-[(METHOXYACETYL)AMINO]-L-ARABINONIC ACID
Biological Unit 4 (1, 1)
No.NameCountTypeFull Name
1U941Ligand/Ion4,5-DIDEOXY-5-(3',5'-DICHLOROBIPHENYL-4-YL)-4-[(METHOXYACETYL)AMINO]-L-ARABINONIC ACID

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPHE A:46 , PRO A:48 , ASN A:50 , THR A:51 , TYR A:52 , TYR A:53 , PHE A:58 , ILE A:128 , ASN A:132 , TYR A:161 , LYS C:18 , HOH C:185 , HOH C:186BINDING SITE FOR RESIDUE U94 A 1
2AC2SOFTWAREPRO B:48 , ASN B:50 , THR B:51 , TYR B:52 , TYR B:53 , PHE B:58 , LEU B:131 , ASN B:132 , TYR B:148 , HOH B:186BINDING SITE FOR RESIDUE U94 B 1
3AC3SOFTWAREGLU C:26 , PHE C:28 , PRO C:48 , ASN C:50 , THR C:51 , TYR C:52 , TYR C:53 , PHE C:58 , ILE C:128 , LEU C:131 , ASN C:132 , TYR C:161BINDING SITE FOR RESIDUE U94 C 1
4AC4SOFTWAREGLU D:26 , PHE D:46 , PRO D:48 , ASN D:50 , THR D:51 , TYR D:52 , TYR D:53 , PHE D:58 , LEU D:131 , ASN D:132 , TYR D:148 , HOH D:185BINDING SITE FOR RESIDUE U94 D 1

(-) SS Bonds  (1, 1)

Asymmetric Unit
No.Residues
1C:93 -D:93

(-) Cis Peptide Bonds  (5, 5)

Asymmetric Unit
No.Residues
1Tyr A:68 -Pro A:69
2Val A:181 -Lys A:182
3Tyr B:68 -Pro B:69
4Tyr C:68 -Pro C:69
5Tyr D:68 -Pro D:69

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3RZ3)

(-) PROSITE Motifs  (2, 7)

Asymmetric Unit (2, 7)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UB2R1_HUMAN11-157
 
 
  3A:11-157
B:11-157
C:11-157
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UB2R1_HUMAN82-97
 
 
 
  4A:82-97
B:82-97
C:82-94
D:82-93
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UB2R1_HUMAN11-157
 
 
  1A:11-157
-
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UB2R1_HUMAN82-97
 
 
 
  1A:82-97
-
-
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UB2R1_HUMAN11-157
 
 
  1-
B:11-157
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UB2R1_HUMAN82-97
 
 
 
  1-
B:82-97
-
-
Biological Unit 3 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UB2R1_HUMAN11-157
 
 
  1-
-
C:11-157
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UB2R1_HUMAN82-97
 
 
 
  1-
-
C:82-94
-
Biological Unit 4 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UB2R1_HUMAN11-157
 
 
  0-
-
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UB2R1_HUMAN82-97
 
 
 
  1-
-
-
D:82-93

(-) Exons   (5, 20)

Asymmetric Unit (5, 20)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002155741ENSE00000655676chr19:531733-532108376UB2R1_HUMAN1-59594A:6-59
B:6-59
C:9-59
D:13-59
54
54
51
47
1.2ENST000002155742ENSE00000655677chr19:535837-53592387UB2R1_HUMAN60-88294A:60-88
B:60-88
C:60-88
D:60-88
29
29
29
29
1.3ENST000002155743ENSE00000655678chr19:536243-53634098UB2R1_HUMAN89-121334A:89-121 (gaps)
B:89-121 (gaps)
C:89-121 (gaps)
D:89-121 (gaps)
33
33
33
33
1.4ENST000002155744ENSE00000655679chr19:537013-537147135UB2R1_HUMAN121-166464A:121-166
B:121-166
C:121-166
D:121-166
46
46
46
46
1.5ENST000002155745ENSE00000655680chr19:541339-542084746UB2R1_HUMAN166-236714A:166-183
B:166-183
C:166-182
D:166-183
18
18
17
18

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:164
 aligned with UB2R1_HUMAN | P49427 from UniProtKB/Swiss-Prot  Length:236

    Alignment length:178
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175        
          UB2R1_HUMAN     6 VPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKV 183
               SCOP domains d3rz3a_ A: automated matches                                                                                                                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh....eeeee.......eeeeeee..........eeeeeee..........eeee....................--------------.......hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -----UBIQUITIN_CONJUGAT_2  PDB: A:11-157 UniProt: 11-157                                                                                                -------------------------- PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------UBIQUITIN_CONJUG-------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1  PDB: A:6-59 UniProt: 1-59 [INCOMPLETE]      Exon 1.2  PDB: A:60-88       Exon 1.3  PDB: A:89-121 (gaps)   --------------------------------------------Exon 1.5           Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------------------------------------Exon 1.4  PDB: A:121-166 UniProt: 121-166     ----------------- Transcript 1 (2)
                 3rz3 A   6 SPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISIL--------------ERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKV 183
                                    15        25        35        45        55        65        75        85        95 |       -      |115       125       135       145       155       165       175        
                                                                                                                      97            112                                                                       

Chain B from PDB  Type:PROTEIN  Length:164
 aligned with UB2R1_HUMAN | P49427 from UniProtKB/Swiss-Prot  Length:236

    Alignment length:178
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175        
          UB2R1_HUMAN     6 VPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKV 183
               SCOP domains d3rz3b_ B: automated matches                                                                                                                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh....eeeee.......eeeeeee..........eeeeeee..........eeee....................--------------.......hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -----UBIQUITIN_CONJUGAT_2  PDB: B:11-157 UniProt: 11-157                                                                                                -------------------------- PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------UBIQUITIN_CONJUG-------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1  PDB: B:6-59 UniProt: 1-59 [INCOMPLETE]      Exon 1.2  PDB: B:60-88       Exon 1.3  PDB: B:89-121 (gaps)   --------------------------------------------Exon 1.5           Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------------------------------------Exon 1.4  PDB: B:121-166 UniProt: 121-166     ----------------- Transcript 1 (2)
                 3rz3 B   6 SPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISIL--------------ERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKV 183
                                    15        25        35        45        55        65        75        85        95 |       -      |115       125       135       145       155       165       175        
                                                                                                                      97            112                                                                       

Chain C from PDB  Type:PROTEIN  Length:156
 aligned with UB2R1_HUMAN | P49427 from UniProtKB/Swiss-Prot  Length:236

    Alignment length:174
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178    
          UB2R1_HUMAN     9 SQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVK 182
               SCOP domains d3rz3c_ C: automated matches                                                                                                                                                   SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhh....eeeee.......eeeeeee..........eeeeeee..........eeee.................------------------..hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --UBIQUITIN_CONJUGAT_2  PDB: C:11-157 UniProt: 11-157                                                                                                ------------------------- PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------UBIQUITIN_CONJUG------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1  PDB: C:9-59 UniProt: 1-59 [INCOMPLETE]   Exon 1.2  PDB: C:60-88       Exon 1.3  PDB: C:89-121 (gaps)   --------------------------------------------Exon 1.5          Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------Exon 1.4  PDB: C:121-166 UniProt: 121-166     ---------------- Transcript 1 (2)
                 3rz3 C   9 SQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCI------------------RWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVK 182
                                    18        28        38        48        58        68        78        88     |   -         -    |  118       128       138       148       158       168       178    
                                                                                                                94                113                                                                     

Chain D from PDB  Type:PROTEIN  Length:146
 aligned with UB2R1_HUMAN | P49427 from UniProtKB/Swiss-Prot  Length:236

    Alignment length:171
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182 
          UB2R1_HUMAN    13 LLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKV 183
               SCOP domains d3rz3d_ D: automated matches                                                                                                                                                SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) UQ_con-3rz3D01 D:13-168                                                                                                                                     --------------- Pfam domains (1)
           Pfam domains (2) UQ_con-3rz3D02 D:13-168                                                                                                                                     --------------- Pfam domains (2)
           Pfam domains (3) UQ_con-3rz3D03 D:13-168                                                                                                                                     --------------- Pfam domains (3)
           Pfam domains (4) UQ_con-3rz3D04 D:13-168                                                                                                                                     --------------- Pfam domains (4)
         Sec.struct. author hhhhhhhhhhh....eeeee.......eeeeeee..........eeeeeee..........eeee................-------------------------hhhhhhhhhhhhhhh.......hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) UBIQUITIN_CONJUGAT_2  PDB: - UniProt: 11-157                                                                                                     -------------------------- PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------UBIQUITIN_CONJUG-------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1  PDB: D:13-59 UniProt: 1-59           Exon 1.2  PDB: D:60-88       Exon 1.3  PDB: D:89-121 (gaps)   --------------------------------------------Exon 1.5           Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------Exon 1.4  PDB: D:121-166 UniProt: 121-166     ----------------- Transcript 1 (2)
                 3rz3 D  13 LLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVC-------------------------NVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKV 183
                                    22        32        42        52        62        72        82        92|        -         -      |122       132       142       152       162       172       182 
                                                                                                           93                       119                                                                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3RZ3)

(-) Pfam Domains  (1, 4)

Asymmetric Unit
(-)
Clan: UBC (69)
(-)
Family: UQ_con (55)
1aUQ_con-3rz3D01D:13-168
1bUQ_con-3rz3D02D:13-168
1cUQ_con-3rz3D03D:13-168
1dUQ_con-3rz3D04D:13-168

(-) Gene Ontology  (24, 24)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (UB2R1_HUMAN | P49427)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0061631    ubiquitin conjugating enzyme activity    Isoenergetic transfer of ubiquitin from one protein to another via the reaction X-ubiquitin + Y -> Y-ubiquitin + X, where both the X-ubiquitin and Y-ubiquitin linkages are thioester bonds between the C-terminal glycine of ubiquitin and a sulfhydryl side group of a cysteine residue.
    GO:0061630    ubiquitin protein ligase activity    Catalysis of the transfer of ubiquitin to a substrate protein via the reaction X-ubiquitin + S -> X + S-ubiquitin, where X is either an E2 or E3 enzyme, the X-ubiquitin linkage is a thioester bond, and the S-ubiquitin linkage is an amide bond: an isopeptide bond between the C-terminal glycine of ubiquitin and the epsilon-amino group of lysine residues in the substrate or, in the linear extension of ubiquitin chains, a peptide bond the between the C-terminal glycine and N-terminal methionine of ubiquitin residues.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
    GO:0004842    ubiquitin-protein transferase activity    Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
biological process
    GO:0006270    DNA replication initiation    The process in which DNA-dependent DNA replication is started; this involves the separation of a stretch of the DNA double helix, the recruitment of DNA polymerases and the initiation of polymerase action.
    GO:0000082    G1/S transition of mitotic cell cycle    The mitotic cell cycle transition by which a cell in G1 commits to S phase. The process begins with the build up of G1 cyclin-dependent kinase (G1 CDK), resulting in the activation of transcription of G1 cyclins. The process ends with the positive feedback of the G1 cyclins on the G1 CDK which commits the cell to S phase, in which DNA replication is initiated.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0006464    cellular protein modification process    The covalent alteration of one or more amino acids occurring in proteins, peptides and nascent polypeptides (co-translational, post-translational modifications) occurring at the level of an individual cell. Includes the modification of charged tRNAs that are destined to occur in a protein (pre-translation modification).
    GO:0035458    cellular response to interferon-beta    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interferon-beta stimulus. Interferon-beta is a type I interferon.
    GO:0043951    negative regulation of cAMP-mediated signaling    Any process which stops, prevents, or reduces the frequency, rate or extent of cAMP-mediated signaling, a series of molecular signals in which a cell uses cyclic AMP to convert an extracellular signal into a response.
    GO:0090261    positive regulation of inclusion body assembly    Any process that increases the rate, frequency, or extent of inclusion body assembly. Inclusion body assembly is the aggregation, arrangement and bonding together of a set of components to form an inclusion body.
    GO:0043525    positive regulation of neuron apoptotic process    Any process that activates or increases the frequency, rate or extent of cell death of neurons by apoptotic process.
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0070936    protein K48-linked ubiquitination    A protein ubiquitination process in which a polymer of ubiquitin, formed by linkages between lysine residues at position 48 of the ubiquitin monomers, is added to a protein. K48-linked ubiquitination targets the substrate protein for degradation.
    GO:0000209    protein polyubiquitination    Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
    GO:0016567    protein ubiquitination    The process in which one or more ubiquitin groups are added to a protein.
    GO:0070848    response to growth factor    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a growth factor stimulus.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    U94  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Tyr A:68 - Pro A:69   [ RasMol ]  
    Tyr B:68 - Pro B:69   [ RasMol ]  
    Tyr C:68 - Pro C:69   [ RasMol ]  
    Tyr D:68 - Pro D:69   [ RasMol ]  
    Val A:181 - Lys A:182   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3rz3
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  UB2R1_HUMAN | P49427
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  6.3.2.19
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  UB2R1_HUMAN | P49427
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        UB2R1_HUMAN | P494272ob4 4mdk

(-) Related Entries Specified in the PDB File

2ob4 HUMAN UBIQUITIN-CONJUGATING ENZYME CDC34