|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (3, 8) |
Asymmetric Unit (3, 3)
|
(no "SS Bond" information available for 3PM7) |
Asymmetric/Biological Unit
|
(no "SAP(SNP)/Variant" information available for 3PM7) |
(no "PROSITE Motif" information available for 3PM7) |
(no "Exon" information available for 3PM7) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:74 aligned with Q82ZD2_ENTFA | Q82ZD2 from UniProtKB/TrEMBL Length:72 Alignment length:74 72 10 20 30 40 50 60 70 | Q82ZD2_ENTFA 1 MKEEFSYEILEEVAVLSENARGWRKELNLISWNGRPPKFDLREWAPDHEKMGKGITLTNEEFAELSKTIKSM-- - SCOP domains -------------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------- Transcript 3pm7 A 1 mKEEFSYEILEEVAVLSENARGWRKELNLISWNGRPPKFDLREWAPDHEKmGKGITLTNEEFAELSKTIKSmLE 74 | 10 20 30 40 50| 60 70 | | 51-MSE 72-MSE 1-MSE Chain B from PDB Type:PROTEIN Length:70 aligned with Q82ZD2_ENTFA | Q82ZD2 from UniProtKB/TrEMBL Length:72 Alignment length:70 72 15 25 35 45 55 65 | - Q82ZD2_ENTFA 6 SYEILEEVAVLSENARGWRKELNLISWNGRPPKFDLREWAPDHEKMGKGITLTNEEFAELSKTIKSM--- - SCOP domains ---------------------------------------------------------------------- SCOP domains CATH domains ---------------------------------------------------------------------- CATH domains Pfam domains (1) DUF2128-3pm7B01 B:6-71 ---- Pfam domains (1) Pfam domains (2) DUF2128-3pm7B02 B:6-71 ---- Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------- Transcript 3pm7 B 6 SYEILEEVAVLSENARGWRKELNLISWNGRPPKFDLREWAPDHEKmGKGITLTNEEFAELSKTIKSmLEH 75 15 25 35 45 | 55 65 | 75 51-MSE 72-MSE
|
(no "SCOP Domain" information available for 3PM7) |
(no "CATH Domain" information available for 3PM7) |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q82ZD2_ENTFA | Q82ZD2)
|
|
|
|
|
|
|