Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CF IM25-CF IM68-UGUAA COMPLEX
 
Authors :  H. Li, S. Tong, X. Li, H. Shi, Y. Gao, H. Ge, L. Niu, M. Teng
Date :  11 Oct 10  (Deposition) - 03 Nov 10  (Release) - 17 Nov 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W
Biol. Unit 1:  A,B,C,D,Q,R  (1x)
Biol. Unit 2:  E,F,G,H,S,W  (1x)
Biol. Unit 3:  I,J,K,L,T  (1x)
Biol. Unit 4:  M,N,O,P,U,V  (1x)
Keywords :  Rrm Domain, Rna Binding, Nuclear, Rna Binding Protein-Rna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Li, S. Tong, X. Li, H. Shi, Y. Gao, H. Ge, L. Niu, M. Teng
Structural Basis Of Pre-Mrna Recognition By The Human Cleavage Factor Im Complex
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR SUBUNIT 5
    ChainsA, B, E, F, I, J, M, N
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentUNP RESIDUES 34-227
    GeneNUDT21, CFIM25, CPSF25, CPSF5
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCLEAVAGE FACTOR IM 25, CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR 25 KDA SUBUNIT, CPSF 25 KDA SUBUNIT, NUCLEOSIDE DIPHOSPHATE-LINKED MOIETY X MOTIF 21, NUDIX MOTIF 21, PRE-MRNA CLEAVAGE FACTOR IM 25 KDA SUBUNIT
 
Molecule 2 - CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR SUBUNIT 6
    ChainsC, D, G, H, K, L, O, P
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentUNP RESIDUES 80-161
    GeneCPSF6, CFIM68
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCLEAVAGE FACTOR IM 68, CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR 68 KDA SUBUNIT, CF IM68, CPSF 68 KDA SUBUNIT, PRE- MRNA CLEAVAGE FACTOR IM 68 KDA SUBUNIT, PROTEIN HPBRII-4/7
 
Molecule 3 - 5'-R(*UP*GP*UP*AP*A)-3'
    ChainsQ, R, S, T, U, V, W
    EngineeredYES
    SyntheticYES

 Structural Features

(-) Chains, Units

  1234567891011121314151617181920212223
Asymmetric Unit ABCDEFGHIJKLMNOPQRSTUVW
Biological Unit 1 (1x)ABCD            QR     
Biological Unit 2 (1x)    EFGH          S   W
Biological Unit 3 (1x)        IJKL       T   
Biological Unit 4 (1x)            MNOP    UV 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3P6Y)

(-) Sites  (0, 0)

(no "Site" information available for 3P6Y)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3P6Y)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Glu I:34 -Arg I:35
2Ser K:159 -Asn K:160

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3P6Y)

(-) PROSITE Motifs  (2, 14)

Asymmetric Unit (2, 14)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1NUDIXPS51462 Nudix hydrolase domain profile.CPSF5_HUMAN76-201
 
 
 
 
 
 
 
  8A:76-201
B:76-201
E:76-201
F:76-201
I:76-201
J:76-201
M:76-201
N:76-201
2RRMPS50102 Eukaryotic RNA Recognition Motif (RRM) profile.CPSF6_HUMAN81-161
 
 
 
 
 
  6C:81-158
D:81-158
G:81-158
K:81-160
L:81-158
O:81-160
Biological Unit 1 (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1NUDIXPS51462 Nudix hydrolase domain profile.CPSF5_HUMAN76-201
 
 
 
 
 
 
 
  2A:76-201
B:76-201
-
-
-
-
-
-
2RRMPS50102 Eukaryotic RNA Recognition Motif (RRM) profile.CPSF6_HUMAN81-161
 
 
 
 
 
  2C:81-158
D:81-158
-
-
-
-
Biological Unit 2 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1NUDIXPS51462 Nudix hydrolase domain profile.CPSF5_HUMAN76-201
 
 
 
 
 
 
 
  2-
-
E:76-201
F:76-201
-
-
-
-
2RRMPS50102 Eukaryotic RNA Recognition Motif (RRM) profile.CPSF6_HUMAN81-161
 
 
 
 
 
  1-
-
G:81-158
-
-
-
Biological Unit 3 (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1NUDIXPS51462 Nudix hydrolase domain profile.CPSF5_HUMAN76-201
 
 
 
 
 
 
 
  2-
-
-
-
I:76-201
J:76-201
-
-
2RRMPS50102 Eukaryotic RNA Recognition Motif (RRM) profile.CPSF6_HUMAN81-161
 
 
 
 
 
  2-
-
-
K:81-160
L:81-158
-
Biological Unit 4 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1NUDIXPS51462 Nudix hydrolase domain profile.CPSF5_HUMAN76-201
 
 
 
 
 
 
 
  2-
-
-
-
-
-
M:76-201
N:76-201
2RRMPS50102 Eukaryotic RNA Recognition Motif (RRM) profile.CPSF6_HUMAN81-161
 
 
 
 
 
  1-
-
-
-
-
O:81-160

(-) Exons   (7, 56)

Asymmetric Unit (7, 56)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003002911ENSE00001482691chr16:56485287-56484999289CPSF5_HUMAN1-39398A:34-39
B:34-39
E:34-39
F:34-39
I:34-39
J:34-39
M:34-39
N:34-39
6
6
6
6
6
6
6
6
1.2ENST000003002912ENSE00001108683chr16:56481901-56481701201CPSF5_HUMAN39-106688A:39-106
B:39-106
E:39-106
F:39-106
I:39-106
J:39-106
M:39-106
N:39-106
68
68
68
68
68
68
68
68
1.3ENST000003002913ENSE00001108681chr16:56480601-5648053864CPSF5_HUMAN106-127228A:106-127
B:106-127
E:106-127
F:106-127
I:106-127
J:106-127
M:106-127
N:106-127
22
22
22
22
22
22
22
22
1.4ENST000003002914ENSE00001108678chr16:56473658-5647356990CPSF5_HUMAN128-157308A:128-157
B:128-157
E:128-157
F:128-157
I:128-157
J:128-157
M:128-157
N:128-157
30
30
30
30
30
30
30
30
1.5ENST000003002915ENSE00001108686chr16:56468741-5646866676CPSF5_HUMAN158-183268A:158-183
B:158-183
E:158-183
F:158-183
I:158-183
J:158-183
M:158-183
N:158-183
26
26
26
26
26
26
26
26
1.6ENST000003002916ENSE00001108677chr16:56468357-56468243115CPSF5_HUMAN183-221398A:183-221
B:183-221
E:183-221
F:183-221
I:183-221
J:183-221
M:183-221
N:183-221
39
39
39
39
39
39
39
39
1.7ENST000003002917ENSE00001108679chr16:56466645-564630453601CPSF5_HUMAN221-22778A:221-227
B:221-227
E:221-227
F:221-227
I:221-227
J:221-227
M:221-227
N:221-227
7
7
7
7
7
7
7
7

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:195
 aligned with CPSF5_HUMAN | O43809 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:195
                                                                                                                                                                                                                           227 
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223   | 
          CPSF5_HUMAN    34 ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN-   -
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.hhh.eeeeee........hhhhhhhhhhhhhhhhh.eeeeeeeeeeee..eeeeeeee.....ee..eee.....hhhhhhhhhhhhhhh.........eeeeeeeeeee...................eeeeeeeee....eeeeee...eeeeeehhhhh.hhhhhhhhhhhhhhhhh..eeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------NUDIX  PDB: A:76-201 UniProt: 76-201                                                                                          --------------------------- PROSITE
           Transcript 1 (1) 1.1   ------------------------------------------------------------------Exon 1.3              Exon 1.4  PDB: A:128-157      Exon 1.5  PDB: A:158-183  -------------------------------------1.7    - Transcript 1 (1)
           Transcript 1 (2) -----Exon 1.2  PDB: A:39-106 UniProt: 39-106                             ----------------------------------------------------------------------------Exon 1.6  PDB: A:183-221               ------- Transcript 1 (2)
                 3p6y A  34 ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYNL 228
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223     

Chain B from PDB  Type:PROTEIN  Length:197
 aligned with CPSF5_HUMAN | O43809 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:197
                                                                                                                                                                                                                           227   
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223   |   
          CPSF5_HUMAN    34 ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN---   -
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.hhh.eeeeee........hhhhhhhhhhhhhhhh..eeeeeeeeeeee..eeeeeeeee...eee..eee.....hhhhhhhhhhhhhhh.........eeeeeeeeeee...................eeeeeeeee....eeeeee...eeeeeehhhhh.hhhhhh.hhhhhhhhhh..eeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------NUDIX  PDB: B:76-201 UniProt: 76-201                                                                                          ----------------------------- PROSITE
           Transcript 1 (1) 1.1   ------------------------------------------------------------------Exon 1.3              Exon 1.4  PDB: B:128-157      Exon 1.5  PDB: B:158-183  -------------------------------------1.7    --- Transcript 1 (1)
           Transcript 1 (2) -----Exon 1.2  PDB: B:39-106 UniProt: 39-106                             ----------------------------------------------------------------------------Exon 1.6  PDB: B:183-221               --------- Transcript 1 (2)
                 3p6y B  34 ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYNLEH 230
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       

Chain C from PDB  Type:PROTEIN  Length:79
 aligned with CPSF6_HUMAN | Q16630 from UniProtKB/Swiss-Prot  Length:551

    Alignment length:79
                                    90       100       110       120       130       140       150         
          CPSF6_HUMAN    81 IALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPC 159
               SCOP domains ------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee......hhhhhhhhhhh.......eeeeee......eeeeeeee..hhhhhhhhhhhh..........eeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) RRM  PDB: C:81-158 UniProt: 81-161                                              PROSITE (2)
                 Transcript ------------------------------------------------------------------------------- Transcript
                 3p6y C  81 IALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPS 159
                                    90       100       110       120       130       140       150         

Chain D from PDB  Type:PROTEIN  Length:78
 aligned with CPSF6_HUMAN | Q16630 from UniProtKB/Swiss-Prot  Length:551

    Alignment length:79
                                    90       100       110       120       130       140       150         
          CPSF6_HUMAN    81 IALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPC 159
               SCOP domains ------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee......hhhhhhhhhhhhh......eeeee......eeeeeeee.-hhhhhhhhhhhhhhh.......eeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) RRM  PDB: D:81-158 UniProt: 81-161                                              PROSITE (2)
                 Transcript ------------------------------------------------------------------------------- Transcript
                 3p6y D  81 IALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGV-SEASSKKLMDLLPKRELHGQNPVVTPS 159
                                    90       100       110       120       130| |    140       150         
                                                                            131 |                          
                                                                              133                          

Chain E from PDB  Type:PROTEIN  Length:195
 aligned with CPSF5_HUMAN | O43809 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:195
                                                                                                                                                                                                                           227 
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223   | 
          CPSF5_HUMAN    34 ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN-   -
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.hhh.eeeeee........hhhhhhhhhhhhhhhh..eeeeeeeeeee....eeeeeeee...eee..eee.....hhhhhhhhhhhhhh..........eeeeeeeeeee...................eeeeeeeee....eeeeee...eeeeeehhhhh.hhhhhhhhhhhhhhhhh..eeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------NUDIX  PDB: E:76-201 UniProt: 76-201                                                                                          --------------------------- PROSITE
           Transcript 1 (1) 1.1   ------------------------------------------------------------------Exon 1.3              Exon 1.4  PDB: E:128-157      Exon 1.5  PDB: E:158-183  -------------------------------------1.7    - Transcript 1 (1)
           Transcript 1 (2) -----Exon 1.2  PDB: E:39-106 UniProt: 39-106                             ----------------------------------------------------------------------------Exon 1.6  PDB: E:183-221               ------- Transcript 1 (2)
                 3p6y E  34 ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYNL 228
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223     

Chain F from PDB  Type:PROTEIN  Length:197
 aligned with CPSF5_HUMAN | O43809 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:197
                                                                                                                                                                                                                           227   
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223   |   
          CPSF5_HUMAN    34 ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN---   -
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.hhh.eeeeee........hhhhhhhhhhhhhhhhh.eeeeeeeeeeee..eeeeeeeee...eee..eee.....hhhhhhhhhhhhhh..........eeeeeeeeeee...................eeeeeeeee....eeeeee...eeeeeehhhhh.hhhhhh.hhhhhhhhhh..eeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------NUDIX  PDB: F:76-201 UniProt: 76-201                                                                                          ----------------------------- PROSITE
           Transcript 1 (1) 1.1   ------------------------------------------------------------------Exon 1.3              Exon 1.4  PDB: F:128-157      Exon 1.5  PDB: F:158-183  -------------------------------------1.7    --- Transcript 1 (1)
           Transcript 1 (2) -----Exon 1.2  PDB: F:39-106 UniProt: 39-106                             ----------------------------------------------------------------------------Exon 1.6  PDB: F:183-221               --------- Transcript 1 (2)
                 3p6y F  34 ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYNLEH 230
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       

Chain G from PDB  Type:PROTEIN  Length:80
 aligned with CPSF6_HUMAN | Q16630 from UniProtKB/Swiss-Prot  Length:551

    Alignment length:80
                                    89        99       109       119       129       139       149       159
          CPSF6_HUMAN    80 RIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPC 159
               SCOP domains -------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee......hhhhhhhhhhhhh...eeeeeeee......eeeeeeeee.hhhhhhhhhhh...........eee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -RRM  PDB: G:81-158 UniProt: 81-161                                              PROSITE (2)
                 Transcript -------------------------------------------------------------------------------- Transcript
                 3p6y G  80 RIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPS 159
                                    89        99       109       119       129       139       149       159

Chain H from PDB  Type:PROTEIN  Length:74
 aligned with CPSF6_HUMAN | Q16630 from UniProtKB/Swiss-Prot  Length:551

    Alignment length:76
                                    92       102       112       122       132       142       152      
          CPSF6_HUMAN    83 LYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTP 158
               SCOP domains ---------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee......hhhhhhhhhh..-.....eeeeee......eeeeeeee.-hhhhhhhhhhhhhhh.......eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) RRM  PDB: - UniProt: 81-161                                                  PROSITE (2)
                 Transcript ---------------------------------------------------------------------------- Transcript
                 3p6y H  83 LYIGNLTWWTTDEDLTEAVHSL-VNDILEIKFFENRANGQSKGFALVGV-SEASSKKLMDLLPKRELHGQNPVVTP 158
                                    92       102 | |   112       122        |-|      142       152      
                                               104 |                      131 |                         
                                                 106                        133                         

Chain I from PDB  Type:PROTEIN  Length:195
 aligned with CPSF5_HUMAN | O43809 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:195
                                                                                                                                                                                                                           227 
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223   | 
          CPSF5_HUMAN    34 ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN-   -
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.hhh.eeeeee........hhhhhhhhhhhhhhhh..eeeeeeeeeeee..eeeeeeeee...eee..eee.....hhhhhhhhhhhhhh..........eeeeeeeeeee...................eeeeeeeee....eeeeee...eeeeeehhhhh.hhhhhhhhhhhhhhhhh..eeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------NUDIX  PDB: I:76-201 UniProt: 76-201                                                                                          --------------------------- PROSITE
           Transcript 1 (1) 1.1   ------------------------------------------------------------------Exon 1.3              Exon 1.4  PDB: I:128-157      Exon 1.5  PDB: I:158-183  -------------------------------------1.7    - Transcript 1 (1)
           Transcript 1 (2) -----Exon 1.2  PDB: I:39-106 UniProt: 39-106                             ----------------------------------------------------------------------------Exon 1.6  PDB: I:183-221               ------- Transcript 1 (2)
                 3p6y I  34 ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYNL 228
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223     

Chain J from PDB  Type:PROTEIN  Length:197
 aligned with CPSF5_HUMAN | O43809 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:197
                                                                                                                                                                                                                           227   
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223   |   
          CPSF5_HUMAN    34 ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN---   -
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.hhh.eeeeee........hhhhhhhhhhhhhhhh..eeeeeeeeeeee..eeeeeeeee...eee..eee.....hhhhhhhhhhhhhh..........eeeeeeeeeee...................eeeeeeeee....eeeeee...eeeeeehhhhh.hhhhhh.hhhhhhhhhh..eeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------NUDIX  PDB: J:76-201 UniProt: 76-201                                                                                          ----------------------------- PROSITE
           Transcript 1 (1) 1.1   ------------------------------------------------------------------Exon 1.3              Exon 1.4  PDB: J:128-157      Exon 1.5  PDB: J:158-183  -------------------------------------1.7    --- Transcript 1 (1)
           Transcript 1 (2) -----Exon 1.2  PDB: J:39-106 UniProt: 39-106                             ----------------------------------------------------------------------------Exon 1.6  PDB: J:183-221               --------- Transcript 1 (2)
                 3p6y J  34 ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYNLEH 230
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       

Chain K from PDB  Type:PROTEIN  Length:80
 aligned with CPSF6_HUMAN | Q16630 from UniProtKB/Swiss-Prot  Length:551

    Alignment length:80
                                    90       100       110       120       130       140       150       160
          CPSF6_HUMAN    81 IALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCN 160
               SCOP domains -------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee......hhhhhhhhhhhh....eeeeeeee......eeeeeeeee.hhhhhhhhhhhh..........eee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) RRM  PDB: K:81-160 UniProt: 81-161                                               PROSITE (2)
                 Transcript -------------------------------------------------------------------------------- Transcript
                 3p6y K  81 IALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPSN 160
                                    90       100       110       120       130       140       150       160

Chain L from PDB  Type:PROTEIN  Length:80
 aligned with CPSF6_HUMAN | Q16630 from UniProtKB/Swiss-Prot  Length:551

    Alignment length:80
                                    89        99       109       119       129       139       149       159
          CPSF6_HUMAN    80 RIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPC 159
               SCOP domains -------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee......hhhhhhhhhhhh....eeeeeeee......eeeeeeeee.hhhhhhhhhhhh..........eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -RRM  PDB: L:81-158 UniProt: 81-161                                              PROSITE (2)
                 Transcript -------------------------------------------------------------------------------- Transcript
                 3p6y L  80 RIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPS 159
                                    89        99       109       119       129       139       149       159

Chain M from PDB  Type:PROTEIN  Length:196
 aligned with CPSF5_HUMAN | O43809 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:196
                                                                                                                                                                                                                           227  
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223   |  
          CPSF5_HUMAN    34 ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN--   -
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee.hhh.eeeeee........hhhhhhhhhhhhhh....eeeeeeeeeeee..eeeeeeee.....ee..eee.....hhhhhhhhhhhhhhh.........eeeeeeeeeee...................eeeeeeeee....eeeeee...eeeeeehhhhh.hhhhhhhhhhhhhhhhh..eeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------NUDIX  PDB: M:76-201 UniProt: 76-201                                                                                          ---------------------------- PROSITE
           Transcript 1 (1) 1.1   ------------------------------------------------------------------Exon 1.3              Exon 1.4  PDB: M:128-157      Exon 1.5  PDB: M:158-183  -------------------------------------1.7    -- Transcript 1 (1)
           Transcript 1 (2) -----Exon 1.2  PDB: M:39-106 UniProt: 39-106                             ----------------------------------------------------------------------------Exon 1.6  PDB: M:183-221               -------- Transcript 1 (2)
                 3p6y M  34 ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYNLE 229
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223      

Chain N from PDB  Type:PROTEIN  Length:197
 aligned with CPSF5_HUMAN | O43809 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:197
                                                                                                                                                                                                                           227   
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223   |   
          CPSF5_HUMAN    34 ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN---   -
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -NUDIX_2-3p6yN01 N:35-222                                                                                                                                                                    -------- Pfam domains (1)
           Pfam domains (2) -NUDIX_2-3p6yN02 N:35-222                                                                                                                                                                    -------- Pfam domains (2)
           Pfam domains (3) -NUDIX_2-3p6yN03 N:35-222                                                                                                                                                                    -------- Pfam domains (3)
           Pfam domains (4) -NUDIX_2-3p6yN04 N:35-222                                                                                                                                                                    -------- Pfam domains (4)
           Pfam domains (5) -NUDIX_2-3p6yN05 N:35-222                                                                                                                                                                    -------- Pfam domains (5)
           Pfam domains (6) -NUDIX_2-3p6yN06 N:35-222                                                                                                                                                                    -------- Pfam domains (6)
           Pfam domains (7) -NUDIX_2-3p6yN07 N:35-222                                                                                                                                                                    -------- Pfam domains (7)
           Pfam domains (8) -NUDIX_2-3p6yN08 N:35-222                                                                                                                                                                    -------- Pfam domains (8)
         Sec.struct. author ..eeee.hhh.eeeeee........hhhhhhhhhhhhhh....eeeeeeeeeeee..eeeeeeeee...eee..eee.....hhhhhhhhhhhhhhh.........eeeeeeeeeee...................eeeeeeeee....eeeeee...eeeeeehhhhh.hhhhhh.hhhhhhhhhh..eeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------NUDIX  PDB: N:76-201 UniProt: 76-201                                                                                          ----------------------------- PROSITE
           Transcript 1 (1) 1.1   ------------------------------------------------------------------Exon 1.3              Exon 1.4  PDB: N:128-157      Exon 1.5  PDB: N:158-183  -------------------------------------1.7    --- Transcript 1 (1)
           Transcript 1 (2) -----Exon 1.2  PDB: N:39-106 UniProt: 39-106                             ----------------------------------------------------------------------------Exon 1.6  PDB: N:183-221               --------- Transcript 1 (2)
                 3p6y N  34 ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYNLEH 230
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       

Chain O from PDB  Type:PROTEIN  Length:80
 aligned with CPSF6_HUMAN | Q16630 from UniProtKB/Swiss-Prot  Length:551

    Alignment length:80
                                    90       100       110       120       130       140       150       160
          CPSF6_HUMAN    81 IALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCN 160
               SCOP domains -------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee......hhhhhhhhhhhh....eeeeeeee......eeeeeeeee.hhhhhhhhhhhhhhh.......eeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) RRM  PDB: O:81-160 UniProt: 81-161                                               PROSITE (2)
                 Transcript -------------------------------------------------------------------------------- Transcript
                 3p6y O  81 IALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPSN 160
                                    90       100       110       120       130       140       150       160

Chain P from PDB  Type:PROTEIN  Length:75
 aligned with CPSF6_HUMAN | Q16630 from UniProtKB/Swiss-Prot  Length:551

    Alignment length:75
                                    93       103       113       123       133       143       153     
          CPSF6_HUMAN    84 YIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTP 158
               SCOP domains --------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------- CATH domains
           Pfam domains (1) RRM_6-3p6yP01 P:84-153                                                ----- Pfam domains (1)
           Pfam domains (2) RRM_6-3p6yP02 P:84-153                                                ----- Pfam domains (2)
           Pfam domains (3) RRM_6-3p6yP03 P:84-153                                                ----- Pfam domains (3)
           Pfam domains (4) RRM_6-3p6yP04 P:84-153                                                ----- Pfam domains (4)
           Pfam domains (5) RRM_6-3p6yP05 P:84-153                                                ----- Pfam domains (5)
           Pfam domains (6) RRM_6-3p6yP06 P:84-153                                                ----- Pfam domains (6)
           Pfam domains (7) RRM_6-3p6yP07 P:84-153                                                ----- Pfam domains (7)
           Pfam domains (8) RRM_6-3p6yP08 P:84-153                                                ----- Pfam domains (8)
         Sec.struct. author .ee......hhhhhhhhhhh.....eeeeeeee......eeeeeeeee.hhhhhhhhhhhhhhh.......ee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) RRM  PDB: - UniProt: 81-161                                                 PROSITE (2)
                 Transcript --------------------------------------------------------------------------- Transcript
                 3p6y P  84 YIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTP 158
                                    93       103       113       123       133       143       153     

Chain Q from PDB  Type:DNA/RNA  Length:2
                                  
                 3p6y Q   1 UG   2

Chain R from PDB  Type:RNA  Length:5
                                     
                 3p6y R   1 UGUAA   5

Chain S from PDB  Type:RNA  Length:5
                                     
                 3p6y S   1 UGUAA   5

Chain T from PDB  Type:RNA  Length:4
                                    
                 3p6y T   1 UGUA   5
                              ||
                              3|
                               5

Chain U from PDB  Type:RNA  Length:4
                                    
                 3p6y U   1 UGUA   5
                              ||
                              3|
                               5

Chain V from PDB  Type:RNA  Length:3
                                   
                 3p6y V   1 UGU   3

Chain W from PDB  Type:RNA  Length:1
                                 
                 3p6y W   1 U   1

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3P6Y)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3P6Y)

(-) Pfam Domains  (2, 16)

Asymmetric Unit
(-)
Clan: NUDIX (85)
(-)
Clan: RRM (206)
(-)
Family: RRM_6 (14)
2aRRM_6-3p6yP01P:84-153
2bRRM_6-3p6yP02P:84-153
2cRRM_6-3p6yP03P:84-153
2dRRM_6-3p6yP04P:84-153
2eRRM_6-3p6yP05P:84-153
2fRRM_6-3p6yP06P:84-153
2gRRM_6-3p6yP07P:84-153
2hRRM_6-3p6yP08P:84-153

(-) Gene Ontology  (23, 33)

Asymmetric Unit(hide GO term definitions)
Chain A,B,E,F,I,J,M,N   (CPSF5_HUMAN | O43809)
molecular function
    GO:0017091    AU-rich element binding    Interacting selectively and non-covalently with a region of RNA containing frequent adenine and uridine bases.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0042826    histone deacetylase binding    Interacting selectively and non-covalently with the enzyme histone deacetylase.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003729    mRNA binding    Interacting selectively and non-covalently with messenger RNA (mRNA), an intermediate molecule between DNA and protein. mRNA includes UTR and coding sequences, but does not contain introns.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
    GO:0031124    mRNA 3'-end processing    Any process involved in forming the mature 3' end of an mRNA molecule.
    GO:0006378    mRNA polyadenylation    The enzymatic addition of a sequence of 40-200 adenylyl residues at the 3' end of a eukaryotic mRNA primary transcript.
    GO:0006397    mRNA processing    Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
    GO:0000398    mRNA splicing, via spliceosome    The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
    GO:0051262    protein tetramerization    The formation of a protein tetramer, a macromolecular structure consisting of four noncovalently associated identical or nonidentical subunits.
    GO:0006369    termination of RNA polymerase II transcription    The process in which the synthesis of an RNA molecule by RNA polymerase II using a DNA template is completed.
cellular component
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0005849    mRNA cleavage factor complex    Any macromolecular complex involved in cleavage or polyadenylation of mRNA molecules.
    GO:0005815    microtubule organizing center    An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0042382    paraspeckles    Discrete subnuclear bodies in the interchromatin nucleoplasmic space, often located adjacent to nuclear specks. 10-20 paraspeckles are typically found in human cell nuclei.

Chain C,D,G,H,K,L,O,P   (CPSF6_HUMAN | Q16630)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0003729    mRNA binding    Interacting selectively and non-covalently with messenger RNA (mRNA), an intermediate molecule between DNA and protein. mRNA includes UTR and coding sequences, but does not contain introns.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006378    mRNA polyadenylation    The enzymatic addition of a sequence of 40-200 adenylyl residues at the 3' end of a eukaryotic mRNA primary transcript.
    GO:0006397    mRNA processing    Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
    GO:0051262    protein tetramerization    The formation of a protein tetramer, a macromolecular structure consisting of four noncovalently associated identical or nonidentical subunits.
cellular component
    GO:0030529    intracellular ribonucleoprotein complex    An intracellular macromolecular complex containing both protein and RNA molecules.
    GO:0005849    mRNA cleavage factor complex    Any macromolecular complex involved in cleavage or polyadenylation of mRNA molecules.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0042382    paraspeckles    Discrete subnuclear bodies in the interchromatin nucleoplasmic space, often located adjacent to nuclear specks. 10-20 paraspeckles are typically found in human cell nuclei.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3p6y)
 
  Sites
(no "Sites" information available for 3p6y)
 
  Cis Peptide Bonds
    Glu I:34 - Arg I:35   [ RasMol ]  
    Ser K:159 - Asn K:160   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3p6y
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CPSF5_HUMAN | O43809
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  CPSF6_HUMAN | Q16630
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CPSF5_HUMAN | O43809
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CPSF6_HUMAN | Q16630
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CPSF5_HUMAN | O438092cl3 2j8q 3bap 3bho 3mdg 3mdi 3n9u 3p5t 3q2s 3q2t
        CPSF6_HUMAN | Q166303p5t 3q2s 3q2t 4b4n 4u0a 4u0b 4wym

(-) Related Entries Specified in the PDB File

3p5t