Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  ZEBRAFISH ALPHAA CRYSTALLIN
 
Authors :  A. Laganowsky, D. Eisenberg
Date :  19 May 10  (Deposition) - 11 Aug 10  (Release) - 13 Oct 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.75
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Protein Chaperone, Eye Lens Transparency, Chaperone (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Laganowsky, D. Eisenberg
Non-3D Domain Swapped Crystal Structure Of Truncated Zebrafish Alphaa Crystallin.
Protein Sci. V. 19 1978 2010
PubMed-ID: 20669149  |  Reference-DOI: 10.1002/PRO.471

(-) Compounds

Molecule 1 - ALPHA A CRYSTALLIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 61- 166
    Gene: CRYAA
    Organism Common: LEOPARD DANIO,ZEBRA DANIO,ZEBRA FISH
    Organism Scientific: DANIO RERIO
    Organism Taxid: 7955
    Synonym: CRYSTALLIN, ALPHA A

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3N3E)

(-) Sites  (0, 0)

(no "Site" information available for 3N3E)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3N3E)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3N3E)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3N3E)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3N3E)

(-) Exons   (0, 0)

(no "Exon" information available for 3N3E)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:106
 aligned with Q8UUZ6_DANRE | Q8UUZ6 from UniProtKB/TrEMBL  Length:173

    Alignment length:106
                                    70        80        90       100       110       120       130       140       150       160      
         Q8UUZ6_DANRE    61 GVSEVRSDREKFTVYLDVKHFSPDELSVKVTDDYVEIQGKHGERQDDHGYISREFHRRYRLPSNVDQSAITCTLSADGLLTLCGPKTSGIDAGRGDRTIPVTREDK 166
               SCOP domains ---------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...eeeeeee....hhh.eeeeee..eeeeeeeeeeee...eeeeeeeeeeee.....hhhhheeee....eeeeeee...........eee.eee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 3n3e A  61 GVSEVRSDREKFTVYLDVKHFSPDELSVKVTDDYVEIQGKHGERQDDHGYISREFHRRYRLPSNVDQSAITCTLSADGLLTLCGPKTSGIDAGRGDRTIPVTREDK 166
                                    70        80        90       100       110       120       130       140       150       160      


Chain B from PDB  Type:PROTEIN  Length:104
 aligned with Q8UUZ6_DANRE | Q8UUZ6 from UniProtKB/TrEMBL  Length:173

    Alignment length:104
                                    71        81        91       101       111       121       131       141       151       161    
         Q8UUZ6_DANRE    62 VSEVRSDREKFTVYLDVKHFSPDELSVKVTDDYVEIQGKHGERQDDHGYISREFHRRYRLPSNVDQSAITCTLSADGLLTLCGPKTSGIDAGRGDRTIPVTRED 165
               SCOP domains -------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --HSP20-3n3eB01 B:64-162                                                                             --- Pfam domains (1)
           Pfam domains (2) --HSP20-3n3eB02 B:64-162                                                                             --- Pfam domains (2)
         Sec.struct. author .eeeee...eeeeeee....hhh.eeeeee..eeeeeeeeeeeee..eeeeeeeeeeee.....hhhhheeee....eeeeeee...........eee.eee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 3n3e B  62 VSEVRSDREKFTVYLDVKHFSPDELSVKVTDDYVEIQGKHGERQDDHGYISREFHRRYRLPSNVDQSAITCTLSADGLLTLCGPKTSGIDAGRGDRTIPVTRED 165
                                    71        81        91       101       111       121       131       141       151       161
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3N3E)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3N3E)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: HSP20 (17)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q8UUZ6_DANRE | Q8UUZ6)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005212    structural constituent of eye lens    The action of a molecule that contributes to the structural integrity of the lens of an eye.
    GO:0051082    unfolded protein binding    Interacting selectively and non-covalently with an unfolded protein.
biological process
    GO:0001654    eye development    The process whose specific outcome is the progression of the eye over time, from its formation to the mature structure. The eye is the organ of sight.
    GO:0007601    visual perception    The series of events required for an organism to receive a visual stimulus, convert it to a molecular signal, and recognize and characterize the signal. Visual stimuli are detected in the form of photons and are processed to form an image.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3n3e)
 
  Sites
(no "Sites" information available for 3n3e)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3n3e)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3n3e
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8UUZ6_DANRE | Q8UUZ6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8UUZ6_DANRE | Q8UUZ6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3N3E)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3N3E)