Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  METABOTROPIC GLUTAMATE RECEPTOR MGLUR1 COMPLEXED WITH LY341495 ANTAGONIST
 
Authors :  E. Dobrovetsky, G. Khutoreskaya, A. Seitova, D. Cossar, A. M. Edwards, C. H. Arrowsmith, C. Bountra, J. Weigelt, A. Bochkarev, Structural G Consortium (Sgc)
Date :  20 Nov 09  (Deposition) - 08 Dec 09  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  A  (1x)
Biol. Unit 3:  B  (1x)
Keywords :  Glutamate Receptors, Mglur1, Dimerization, Glutamic Acid Binding, Structural Genomics, Structural Genomics Consortium, Sgc, Cell Membrane, G-Protein Coupled Receptor, Glycoprotein, Membrane, Phosphoprotein, Receptor, Transducer, Transmembrane, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. Dobrovetsky, G. Khutoreskaya, A. Seitova, D. Cossar, A. M. Edwards C. H. Arrowsmith, C. Bountra, J. Weigelt, A. Bochkarev
Metabotropic Glutamate Receptor Mglur1 Complexed With Ly341495 Antagonist
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - METABOTROPIC GLUTAMATE RECEPTOR 1
    ChainsA, B
    EngineeredYES
    Expression SystemBACULOVIRUS
    Expression System PlasmidPFHMSP-LIC-C
    Expression System StrainSF9 INSECT CELLS
    Expression System Taxid10469
    Expression System Vector TypePLASMID
    GeneGPRC1A, GRM1, MGLUR1
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMGLUR1

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)AB
Biological Unit 2 (1x)A 
Biological Unit 3 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 6)

Asymmetric Unit (3, 6)
No.NameCountTypeFull Name
1MG2Ligand/IonMAGNESIUM ION
2NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
3Z992Ligand/Ion2-[(1S,2S)-2-CARBOXYCYCLOPROPYL]-3-(9H-XANTHEN-9-YL)-D-ALANINE
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
1MG-1Ligand/IonMAGNESIUM ION
2NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
3Z992Ligand/Ion2-[(1S,2S)-2-CARBOXYCYCLOPROPYL]-3-(9H-XANTHEN-9-YL)-D-ALANINE
Biological Unit 2 (2, 3)
No.NameCountTypeFull Name
1MG-1Ligand/IonMAGNESIUM ION
2NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
3Z991Ligand/Ion2-[(1S,2S)-2-CARBOXYCYCLOPROPYL]-3-(9H-XANTHEN-9-YL)-D-ALANINE
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
1MG-1Ligand/IonMAGNESIUM ION
2NAG-1Ligand/IonN-ACETYL-D-GLUCOSAMINE
3Z991Ligand/Ion2-[(1S,2S)-2-CARBOXYCYCLOPROPYL]-3-(9H-XANTHEN-9-YL)-D-ALANINE

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:74 , TRP A:110 , GLY A:163 , SER A:164 , SER A:165 , SER A:186 , ALA A:187 , THR A:188 , TYR A:236 , HOH A:627 , HOH A:761 , HOH A:825BINDING SITE FOR RESIDUE Z99 A 1
2AC2SOFTWAREILE A:89 , ASN A:90 , ASP A:92 , LEU A:95 , LEU A:96 , HOH A:614BINDING SITE FOR RESIDUE MG A 524
3AC3SOFTWAREARG A:221 , TYR A:222 , ASN A:223 , HOH A:617BINDING SITE FOR RESIDUE NAG A 525
4AC4SOFTWARETHR A:395 , ASN A:397BINDING SITE FOR RESIDUE NAG A 526
5AC5SOFTWARETYR B:74 , TRP B:110 , GLY B:163 , SER B:164 , SER B:165 , SER B:186 , ALA B:187 , THR B:188 , TYR B:236 , ASP B:318 , GLY B:319 , HOH B:549 , HOH B:621 , HOH B:740BINDING SITE FOR RESIDUE Z99 B 1
6AC6SOFTWAREILE B:89 , ASN B:90 , ASP B:92 , LEU B:95 , LEU B:96 , HOH B:744BINDING SITE FOR RESIDUE MG B 524

(-) SS Bonds  (6, 6)

Asymmetric Unit
No.Residues
1A:67 -A:109
2A:378 -A:394
3A:432 -A:439
4B:67 -B:109
5B:378 -B:394
6B:432 -B:439

(-) Cis Peptide Bonds  (6, 6)

Asymmetric Unit
No.Residues
1Gly A:161 -Pro A:162
2Leu A:281 -Pro A:282
3Lys A:443 -Pro A:444
4Gly B:161 -Pro B:162
5Leu B:281 -Pro B:282
6Lys B:443 -Pro B:444

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 2)

Asymmetric Unit (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_028185R285KGRM1_HUMANPolymorphism7760248A/BR285K

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_028185R285KGRM1_HUMANPolymorphism7760248A/BR285K

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_028185R285KGRM1_HUMANPolymorphism7760248AR285K

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_028185R285KGRM1_HUMANPolymorphism7760248BR285K

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1G_PROTEIN_RECEP_F3_1PS00979 G-protein coupled receptors family 3 signature 1.GRM1_HUMAN171-189
 
  2A:171-189
B:171-189
Biological Unit 1 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1G_PROTEIN_RECEP_F3_1PS00979 G-protein coupled receptors family 3 signature 1.GRM1_HUMAN171-189
 
  2A:171-189
B:171-189
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1G_PROTEIN_RECEP_F3_1PS00979 G-protein coupled receptors family 3 signature 1.GRM1_HUMAN171-189
 
  1A:171-189
-
Biological Unit 3 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1G_PROTEIN_RECEP_F3_1PS00979 G-protein coupled receptors family 3 signature 1.GRM1_HUMAN171-189
 
  1-
B:171-189

(-) Exons   (5, 10)

Asymmetric Unit (5, 10)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003617191aENSE00001627194chr6:146348782-146348928147GRM1_HUMAN-00--
1.2aENST000003617192aENSE00002199205chr6:146350331-1463513531023GRM1_HUMAN1-2342342A:35-234 (gaps)
B:35-234 (gaps)
200
200
1.3aENST000003617193aENSE00000975751chr6:146480484-146480733250GRM1_HUMAN234-317842A:234-317
B:234-317
84
84
1.4ENST000003617194ENSE00001084911chr6:146625747-146625982236GRM1_HUMAN317-396802A:317-396 (gaps)
B:317-396 (gaps)
80
80
1.5ENST000003617195ENSE00001084909chr6:146673386-146673632247GRM1_HUMAN396-478832A:396-478
B:396-478
83
83
1.6ENST000003617196ENSE00001084916chr6:146678662-146678830169GRM1_HUMAN478-534572A:478-512 (gaps)
B:478-509
35
32
1.7ENST000003617197ENSE00001084910chr6:146708026-146708152127GRM1_HUMAN535-577430--
1.8ENST000003617198ENSE00001084914chr6:146719905-146720835931GRM1_HUMAN577-8873110--
1.10aENST0000036171910aENSE00002200190chr6:146755008-1467587313724GRM1_HUMAN887-11943080--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:445
 aligned with GRM1_HUMAN | Q13255 from UniProtKB/Swiss-Prot  Length:1194

    Alignment length:478
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504        
           GRM1_HUMAN    35 QRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDGINRCLPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKI 512
               SCOP domains d3ks9a_ A: automated matches                                                                                                                                                                                                                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee...eeeeeee......hhhhh............hhhhhhhhhhhhhhhhh.........eeeeeee...hhhhhhhhhhhhhh...--------------------------..eeeee...hhhhhhhhhhhhhhhh..eee....hhhhhh......eee....hhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhhhhhhhhh..eeeeeeee....hhhhhhhhhhhhhh......eeeee.hhhhhhhhhhhhhhhh.....eeee......hhhhhh.hhhhhh..eeeee....hhhhhhhhh...........hhhhhhhhhh......-----.....................hhhhhhhhhhhhhhhhhhhhhhhh......hhhhh..hhhhhhhhhhh.eee.....eee.........eeeeeeeee..--.eeeeeeeeee..eeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------K----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------G_PROTEIN_RECEP_F3_----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: A:35-234 (gaps) UniProt: 1-234 [INCOMPLETE]                                                                                                                                             ----------------------------------------------------------------------------------Exon 1.4  PDB: A:317-396 (gaps) UniProt: 317-396                                ---------------------------------------------------------------------------------Exon 1.6  PDB: A:478-512 (gaps)     Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.3a  PDB: A:234-317 UniProt: 234-317                                          ------------------------------------------------------------------------------Exon 1.5  PDB: A:396-478 UniProt: 396-478                                          ---------------------------------- Transcript 1 (2)
                 3ks9 A  35 QRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSL--------------------------KPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLSIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPG-----PNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQYTE--RYDYVHVGTWHEGVLNIDDYKI 512
                                    44        54        64        74        84        94       104       114       124  |      -         -       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       | -   |   394       404       414       424       434       444       454       464       474       484   |  |494       504        
                                                                                                                      127                        154                                                                                                                                                                                                                                 382   388                                                                                                 488  |                     
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  491                     

Chain B from PDB  Type:PROTEIN  Length:442
 aligned with GRM1_HUMAN | Q13255 from UniProtKB/Swiss-Prot  Length:1194

    Alignment length:475
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504     
           GRM1_HUMAN    35 QRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDGINRCLPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDD 509
               SCOP domains d3ks9b_ B: automated matches                                                                                                                                                                                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee...eeeeeee......hhhhh............hhhhhhhhhhhhhhhhhh........eeeeeee...hhhhhhhhhhhhhhh..--------------------------..eeeee...hhhhhhhhhhhhhhhh..eee....hhhhhh......eee....hhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhhhhhhh....eeeeeeee....hhhhhhhhhhhhhhh.....eeeee.hhhhhhhhhhhhhhhh.....eeee......hhhhhh.hhhhhh..eeeee....hhhhhhhhh...........hhhhhhhhhh....-------.....................hhhhhhhhhhhhhhhhhhhhhhhh......hhhhh..hhhhhhhhhhh.eee.....eee.........eeeeeeeee.....eeeeeeeeee..eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------K-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------G_PROTEIN_RECEP_F3_-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: B:35-234 (gaps) UniProt: 1-234 [INCOMPLETE]                                                                                                                                             ----------------------------------------------------------------------------------Exon 1.4  PDB: B:317-396 (gaps) UniProt: 317-396                                ---------------------------------------------------------------------------------Exon 1.6  PDB: B:478-509         Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.3a  PDB: B:234-317 UniProt: 234-317                                          ------------------------------------------------------------------------------Exon 1.5  PDB: B:396-478 UniProt: 396-478                                          ------------------------------- Transcript 1 (2)
                 3ks9 B  35 QRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSL--------------------------KPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLSIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRL-------PNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDD 509
                                    44        54        64        74        84        94       104       114       124  |      -         -       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374     |   -   |   394       404       414       424       434       444       454       464       474       484       494       504     
                                                                                                                      127                        154                                                                                                                                                                                                                               380     388                                                                                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3KS9)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3KS9)

(-) Gene Ontology  (29, 29)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (GRM1_HUMAN | Q13255)
molecular function
    GO:0004930    G-protein coupled receptor activity    Combining with an extracellular signal and transmitting the signal across the membrane by activating an associated G-protein; promotes the exchange of GDP for GTP on the alpha subunit of a heterotrimeric G-protein complex.
    GO:0008066    glutamate receptor activity    Combining with glutamate and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004871    signal transducer activity    Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
biological process
    GO:0007216    G-protein coupled glutamate receptor signaling pathway    A series of molecular signals initiated by glutamate binding to a glutamate receptor on the surface of the target cell, and proceeding with the activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. Ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0007186    G-protein coupled receptor signaling pathway    A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
    GO:0000187    activation of MAPK activity    The initiation of the activity of the inactive enzyme MAP kinase (MAPK).
    GO:0000186    activation of MAPKK activity    The initiation of the activity of the inactive enzyme MAP kinase kinase (MAPKK).
    GO:0071257    cellular response to electrical stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an electrical stimulus.
    GO:0007268    chemical synaptic transmission    The vesicular release of classical neurotransmitter molecules from a presynapse, across a chemical synapse, the subsequent activation of neurotransmitter receptors at the postsynapse of a target cell (neuron, muscle, or secretory cell) and the effects of this activation on the postsynaptic membrane potential and ionic composition of the postsynaptic cytosol. This process encompasses both spontaneous and evoked release of neurotransmitter and all parts of synaptic vesicle exocytosis. Evoked transmission starts with the arrival of an action potential at the presynapse.
    GO:0038042    dimeric G-protein coupled receptor signaling pathway    A series of molecular signals initiated by an extracellular signal combining with a dimeric receptor on the surface of the target cell, and proceeding with the activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. Heterodimeric and homodimeric GPCRs may have different functional properties from those of the respective monomers.
    GO:0007626    locomotory behavior    The specific movement from place to place of an organism in response to external or internal stimuli. Locomotion of a whole organism in a manner dependent upon some combination of that organism's internal state and external conditions.
    GO:0051482    positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway    Any process that increases the concentration of calcium ions in the cytosol that occurs as part of a PLC-activating G-protein coupled receptor signaling pathway. G-protein-activated PLC hydrolyses phosphatidylinositol-bisphosphate (PIP2) to release diacylglycerol (DAG) and inositol trisphosphate (IP3). IP3 then binds to calcium release channels in the endoplasmic reticulum (ER) to trigger calcium ion release into the cytosol.
    GO:0007205    protein kinase C-activating G-protein coupled receptor signaling pathway    The series of molecular signals generated as a consequence of a G-protein coupled receptor binding to its physiological ligand, where the pathway proceeds with activation of protein kinase C (PKC). PKC is activated by second messengers including diacylglycerol (DAG).
    GO:0043408    regulation of MAPK cascade    Any process that modulates the frequency, rate or extent of signal transduction mediated by the MAP kinase (MAPK) cascade.
    GO:0051930    regulation of sensory perception of pain    Any process that modulates the frequency, rate or extent of the sensory perception of pain, the series of events required for an organism to receive a painful stimulus, convert it to a molecular signal, and recognize and characterize the signal.
    GO:0051966    regulation of synaptic transmission, glutamatergic    Any process that modulates the frequency, rate or extent of glutamatergic synaptic transmission, the process of communication from a neuron to another neuron across a synapse using the neurotransmitter glutamate.
    GO:0019233    sensory perception of pain    The series of events required for an organism to receive a painful stimulus, convert it to a molecular signal, and recognize and characterize the signal. Pain is medically defined as the physical sensation of discomfort or distress caused by injury or illness, so can hence be described as a harmful stimulus which signals current (or impending) tissue damage. Pain may come from extremes of temperature, mechanical damage, electricity or from noxious chemical substances. This is a neurological process.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
    GO:0038037    G-protein coupled receptor dimeric complex    A protein complex that contains two G-protein coupled receptors.
    GO:0038038    G-protein coupled receptor homodimeric complex    A protein complex that contains two G-protein coupled receptors (GPCRs) of the same subtype. Formation of a GPCR homodimer may be important for the transport of newly formed receptors to the cell surface, and the function of the receptor.
    GO:0030425    dendrite    A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0043005    neuron projection    A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0014069    postsynaptic density of dendrite    An electron dense network of proteins within and adjacent to the postsynaptic membrane of the dendrite of asymetric synapses. Its major components include neurotransmitter receptors and the proteins that spatially and functionally organize them such as anchoring and scaffolding molecules, signaling enzymes and cytoskeletal components.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    Z99  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:161 - Pro A:162   [ RasMol ]  
    Gly B:161 - Pro B:162   [ RasMol ]  
    Leu A:281 - Pro A:282   [ RasMol ]  
    Leu B:281 - Pro B:282   [ RasMol ]  
    Lys A:443 - Pro A:444   [ RasMol ]  
    Lys B:443 - Pro B:444   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3ks9
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GRM1_HUMAN | Q13255
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GRM1_HUMAN | Q13255
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GRM1_HUMAN | Q132554or2

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3KS9)