Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN MITOCHONDRIAL DNA POLYMERASE HOLOENZYME
 
Authors :  Y-S. Lee, W. D. Kennedy, Y. W. Yin
Date :  06 Aug 09  (Deposition) - 03 Nov 09  (Release) - 03 Nov 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.24
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,B,C  (1x)
Biol. Unit 2:  D,E,F  (1x)
Keywords :  Human Mitochondrial Dna Polymerase, Disease Mutation, Dna Replication, Dna-Binding, Dna-Directed Dna Polymerase, Magnesium, Mitochondrion, Neuropathy, Nucleotidyltransferase, Polymorphism, Progressive External Ophthalmoplegia, Transferase, Transit Peptide (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. S. Lee, W. D. Kennedy, Y. W. Yin
Structural Insight Into Processive Human Mitochondrial Dna Synthesis And Disease-Related Polymerase Mutations.
Cell(Cambridge, Mass. ) V. 139 312 2009
PubMed-ID: 19837034  |  Reference-DOI: 10.1016/J.CELL.2009.07.050
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - DNA POLYMERASE SUBUNIT GAMMA-1
    ChainsA, D
    EC Number2.7.7.7
    FragmentUNP RESIDUES 70-1239
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMITOCHONDRIAL DNA POLYMERASE CATALYTIC SUBUNIT, POLG-ALPHA
 
Molecule 2 - DNA POLYMERASE SUBUNIT GAMMA-2
    ChainsB, C, E, F
    EC Number2.7.7.7
    FragmentUNP RESIDUES 59-485
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT, POLG-BETA, MTPOLB, DNA POLYMERASE GAMMA ACCESSORY 55 KDA SUBUNIT, P55

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit ABCDEF
Biological Unit 1 (1x)ABC   
Biological Unit 2 (1x)   DEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3IKM)

(-) Sites  (0, 0)

(no "Site" information available for 3IKM)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3IKM)

(-) Cis Peptide Bonds  (21, 21)

Asymmetric Unit
No.Residues
1Ser A:255 -Pro A:256
2Leu A:634 -Pro A:635
3Gly A:724 -Pro A:725
4Leu A:752 -Pro A:753
5Thr A:1199 -Pro A:1200
6Asn A:1202 -Pro A:1203
7Leu B:204 -Pro B:205
8Gly B:390 -Pro B:391
9Gly C:390 -Pro C:391
10Ser D:216 -Pro D:217
11Ser D:255 -Pro D:256
12Pro D:368 -Leu D:369
13Leu D:566 -Pro D:567
14Met D:669 -Pro D:670
15Gly D:724 -Pro D:725
16Leu D:752 -Pro D:753
17Leu D:821 -Pro D:822
18Thr D:1199 -Pro D:1200
19Leu E:204 -Pro E:205
20His E:375 -Pro E:376
21Gly F:390 -Pro F:391

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (69, 142)

Asymmetric Unit (69, 142)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_019267R193QDPOG1_HUMANPolymorphism3176162A/DR193Q
02UniProtVAR_023663R227WDPOG1_HUMANDisease (PEOB1)121918056A/DR227W
03UniProtVAR_058870R232GDPOG1_HUMANDisease (MTDPS4A)  ---A/DR232G
04UniProtVAR_058871R232HDPOG1_HUMANDisease (LS)113994093A/DR232H
05UniProtVAR_058872L244PDPOG1_HUMANDisease (MTDPS4A)  ---A/DL244P
06UniProtVAR_023664T251IDPOG1_HUMANDisease (PEOB1)113994094A/DT251I
07UniProtVAR_058873G268ADPOG1_HUMANDisease (PEOB1)61752784A/DG268A
08UniProtVAR_012154L304RDPOG1_HUMANDisease (PEOB1)121918044A/DL304R
09UniProtVAR_058875Q308HDPOG1_HUMANDisease (PEOB1)745539599A/DQ308H
10UniProtVAR_023665R309LDPOG1_HUMANDisease (PEOB1)  ---A/DR309L
11UniProtVAR_023666W312RDPOG1_HUMANDisease (PEOB1)  ---A/DW312R
12UniProtVAR_058876G380DDPOG1_HUMANDisease (PEOB1)  ---A/DG380D
13UniProtVAR_032029G416ADPOG2_HUMANPolymorphism17850455B/C/E/FG416A
14UniProtVAR_023667G431VDPOG1_HUMANDisease (PEOB1)  ---A/DG431V
15UniProtVAR_029364G451EDPOG2_HUMANDisease (PEOA4)104894632B/C/E/FG451E
16UniProtVAR_058877L463FDPOG1_HUMANPolymorphism150828914A/DL463F
17UniProtVAR_012155A467TDPOG1_HUMANDisease (SCAE)113994095A/DA467T
18UniProtVAR_023668N468DDPOG1_HUMANDisease (PEOB1)145843073A/DN468D
19UniProtVAR_023669Q497HDPOG1_HUMANDisease (SCAE)121918052A/DQ497H
20UniProtVAR_058878S511NDPOG1_HUMANDisease (PEOA1)121918055A/DS511N
21UniProtVAR_058879G517VDPOG1_HUMANDisease (SANDO)61752783A/DG517V
22UniProtVAR_014906R546CDPOG1_HUMANPolymorphism2307447A/DR546C
23UniProtVAR_058880R562QDPOG1_HUMANDisease (PEOB1)781168350A/DR562Q
24UniProtVAR_058881R574WDPOG1_HUMANDisease (PEOB1)774474723A/DR574W
25UniProtVAR_023670R579WDPOG1_HUMANDisease (PEOB1)556925652A/DR579W
26UniProtVAR_023671P587LDPOG1_HUMANDisease (PEOB1)113994096A/DP587L
27UniProtVAR_058882M603LDPOG1_HUMANDisease (PEOB1)  ---A/DM603L
28UniProtVAR_058883R627QDPOG1_HUMANDisease (SANDO)375305567A/DR627Q
29UniProtVAR_023672R627WDPOG1_HUMANDisease (SANDO)121918046A/DR627W
30UniProtVAR_058884P648RDPOG1_HUMANDisease (PEOB1)796052906A/DP648R
31UniProtVAR_014907E662KDPOG1_HUMANPolymorphism2307450A/DE662K
32UniProtVAR_058885G737RDPOG1_HUMANDisease (PEOB1)121918054A/DG737R
33UniProtVAR_023673W748SDPOG1_HUMANDisease (SCAE)113994097A/DW748S
34UniProtVAR_058886A767DDPOG1_HUMANDisease (MTDPS4A)  ---A/DA767D
35UniProtVAR_058887R807CDPOG1_HUMANDisease (SANDO)769827124A/DR807C
36UniProtVAR_058888R807PDPOG1_HUMANDisease (PEOB1)  ---A/DR807P
37UniProtVAR_023674Y831CDPOG1_HUMANUnclassified (PEOA1)4154971A/DY831C
38UniProtVAR_023675G848SDPOG1_HUMANDisease (PEOB1)113994098A/DG848S
39UniProtVAR_058889R853WDPOG1_HUMANDisease (PEOB1)121918053A/DR853W
40UniProtVAR_023676N864SDPOG1_HUMANDisease (MTDPS4B)121918050A/DN864S
41UniProtVAR_058890Q879HDPOG1_HUMANDisease (MTDPS4A)  ---A/DQ879H
42UniProtVAR_058891T885SDPOG1_HUMANDisease (MTDPS4A)  ---A/DT885S
43UniProtVAR_023677A889TDPOG1_HUMANDisease (PEOB1)763393580A/DA889T
44UniProtVAR_058892T914PDPOG1_HUMANDisease (MTDPS4A)139590686A/DT914P
45UniProtVAR_023678G923DDPOG1_HUMANDisease (PEOA1)  ---A/DG923D
46UniProtVAR_023679H932YDPOG1_HUMANDisease (SANDO)121918048A/DH932Y
47UniProtVAR_023680R943HDPOG1_HUMANDisease (PEOA1)  ---A/DR943H
48UniProtVAR_023681R953CDPOG1_HUMANDisease (PEOA1)11546842A/DR953C
49UniProtVAR_012156Y955CDPOG1_HUMANDisease (PEOA1)113994099A/DY955C
50UniProtVAR_058893A957PDPOG1_HUMANDisease (MTDPS4A)  ---A/DA957P
51UniProtVAR_023682A957SDPOG1_HUMANDisease (PEOA1)121918051A/DA957S
52UniProtVAR_023683R1047QDPOG1_HUMANDisease (PEOB1)768028281A/DR1047Q
53UniProtVAR_023684G1051RDPOG1_HUMANDisease (SANDO)121918049A/DG1051R
54UniProtVAR_023686R1096CDPOG1_HUMANDisease (PEOB1)201732356A/DR1096C
55UniProtVAR_058894R1096HDPOG1_HUMANDisease (MTDPS4A)368435864A/DR1096H
56UniProtVAR_023687S1104CDPOG1_HUMANDisease (PEOB1)  ---A/DS1104C
57UniProtVAR_023688A1105TDPOG1_HUMANDisease (PEOB1)753410045A/DA1105T
58UniProtVAR_023689V1106IDPOG1_HUMANDisease (PEOB1)  ---A/DV1106I
59UniProtVAR_058895H1110YDPOG1_HUMANDisease (MTDPS4A)  ---A/DH1110Y
60UniProtVAR_058896H1134RDPOG1_HUMANDisease (MTDPS4A)  ---A/DH1134R
61UniProtVAR_065092E1136KDPOG1_HUMANDisease (MTDPS4A)56047213A/DE1136K
62UniProtVAR_014908R1142WDPOG1_HUMANPolymorphism2307442A/DR1142W
63UniProtVAR_014909E1143GDPOG1_HUMANPolymorphism2307441A/DE1143G
64UniProtVAR_014910R1146CDPOG1_HUMANDisease (PEOB1)2307440A/DR1146C
65UniProtVAR_023690S1176LDPOG1_HUMANDisease (PEOA1)776031396A/DS1176L
66UniProtVAR_058897D1184NDPOG1_HUMANDisease (PEOB1)  ---A/DD1184N
67UniProtVAR_065119D1186HDPOG1_HUMANDisease (PEOA1)  ---A/DD1186H
68UniProtVAR_058898K1191NDPOG1_HUMANDisease (MTDPS4A)  ---A/DK1191N
69UniProtVAR_014911Q1236HDPOG1_HUMANPolymorphism3087374A/DQ1236H

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (69, 71)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_019267R193QDPOG1_HUMANPolymorphism3176162AR193Q
02UniProtVAR_023663R227WDPOG1_HUMANDisease (PEOB1)121918056AR227W
03UniProtVAR_058870R232GDPOG1_HUMANDisease (MTDPS4A)  ---AR232G
04UniProtVAR_058871R232HDPOG1_HUMANDisease (LS)113994093AR232H
05UniProtVAR_058872L244PDPOG1_HUMANDisease (MTDPS4A)  ---AL244P
06UniProtVAR_023664T251IDPOG1_HUMANDisease (PEOB1)113994094AT251I
07UniProtVAR_058873G268ADPOG1_HUMANDisease (PEOB1)61752784AG268A
08UniProtVAR_012154L304RDPOG1_HUMANDisease (PEOB1)121918044AL304R
09UniProtVAR_058875Q308HDPOG1_HUMANDisease (PEOB1)745539599AQ308H
10UniProtVAR_023665R309LDPOG1_HUMANDisease (PEOB1)  ---AR309L
11UniProtVAR_023666W312RDPOG1_HUMANDisease (PEOB1)  ---AW312R
12UniProtVAR_058876G380DDPOG1_HUMANDisease (PEOB1)  ---AG380D
13UniProtVAR_032029G416ADPOG2_HUMANPolymorphism17850455B/CG416A
14UniProtVAR_023667G431VDPOG1_HUMANDisease (PEOB1)  ---AG431V
15UniProtVAR_029364G451EDPOG2_HUMANDisease (PEOA4)104894632B/CG451E
16UniProtVAR_058877L463FDPOG1_HUMANPolymorphism150828914AL463F
17UniProtVAR_012155A467TDPOG1_HUMANDisease (SCAE)113994095AA467T
18UniProtVAR_023668N468DDPOG1_HUMANDisease (PEOB1)145843073AN468D
19UniProtVAR_023669Q497HDPOG1_HUMANDisease (SCAE)121918052AQ497H
20UniProtVAR_058878S511NDPOG1_HUMANDisease (PEOA1)121918055AS511N
21UniProtVAR_058879G517VDPOG1_HUMANDisease (SANDO)61752783AG517V
22UniProtVAR_014906R546CDPOG1_HUMANPolymorphism2307447AR546C
23UniProtVAR_058880R562QDPOG1_HUMANDisease (PEOB1)781168350AR562Q
24UniProtVAR_058881R574WDPOG1_HUMANDisease (PEOB1)774474723AR574W
25UniProtVAR_023670R579WDPOG1_HUMANDisease (PEOB1)556925652AR579W
26UniProtVAR_023671P587LDPOG1_HUMANDisease (PEOB1)113994096AP587L
27UniProtVAR_058882M603LDPOG1_HUMANDisease (PEOB1)  ---AM603L
28UniProtVAR_058883R627QDPOG1_HUMANDisease (SANDO)375305567AR627Q
29UniProtVAR_023672R627WDPOG1_HUMANDisease (SANDO)121918046AR627W
30UniProtVAR_058884P648RDPOG1_HUMANDisease (PEOB1)796052906AP648R
31UniProtVAR_014907E662KDPOG1_HUMANPolymorphism2307450AE662K
32UniProtVAR_058885G737RDPOG1_HUMANDisease (PEOB1)121918054AG737R
33UniProtVAR_023673W748SDPOG1_HUMANDisease (SCAE)113994097AW748S
34UniProtVAR_058886A767DDPOG1_HUMANDisease (MTDPS4A)  ---AA767D
35UniProtVAR_058887R807CDPOG1_HUMANDisease (SANDO)769827124AR807C
36UniProtVAR_058888R807PDPOG1_HUMANDisease (PEOB1)  ---AR807P
37UniProtVAR_023674Y831CDPOG1_HUMANUnclassified (PEOA1)4154971AY831C
38UniProtVAR_023675G848SDPOG1_HUMANDisease (PEOB1)113994098AG848S
39UniProtVAR_058889R853WDPOG1_HUMANDisease (PEOB1)121918053AR853W
40UniProtVAR_023676N864SDPOG1_HUMANDisease (MTDPS4B)121918050AN864S
41UniProtVAR_058890Q879HDPOG1_HUMANDisease (MTDPS4A)  ---AQ879H
42UniProtVAR_058891T885SDPOG1_HUMANDisease (MTDPS4A)  ---AT885S
43UniProtVAR_023677A889TDPOG1_HUMANDisease (PEOB1)763393580AA889T
44UniProtVAR_058892T914PDPOG1_HUMANDisease (MTDPS4A)139590686AT914P
45UniProtVAR_023678G923DDPOG1_HUMANDisease (PEOA1)  ---AG923D
46UniProtVAR_023679H932YDPOG1_HUMANDisease (SANDO)121918048AH932Y
47UniProtVAR_023680R943HDPOG1_HUMANDisease (PEOA1)  ---AR943H
48UniProtVAR_023681R953CDPOG1_HUMANDisease (PEOA1)11546842AR953C
49UniProtVAR_012156Y955CDPOG1_HUMANDisease (PEOA1)113994099AY955C
50UniProtVAR_058893A957PDPOG1_HUMANDisease (MTDPS4A)  ---AA957P
51UniProtVAR_023682A957SDPOG1_HUMANDisease (PEOA1)121918051AA957S
52UniProtVAR_023683R1047QDPOG1_HUMANDisease (PEOB1)768028281AR1047Q
53UniProtVAR_023684G1051RDPOG1_HUMANDisease (SANDO)121918049AG1051R
54UniProtVAR_023686R1096CDPOG1_HUMANDisease (PEOB1)201732356AR1096C
55UniProtVAR_058894R1096HDPOG1_HUMANDisease (MTDPS4A)368435864AR1096H
56UniProtVAR_023687S1104CDPOG1_HUMANDisease (PEOB1)  ---AS1104C
57UniProtVAR_023688A1105TDPOG1_HUMANDisease (PEOB1)753410045AA1105T
58UniProtVAR_023689V1106IDPOG1_HUMANDisease (PEOB1)  ---AV1106I
59UniProtVAR_058895H1110YDPOG1_HUMANDisease (MTDPS4A)  ---AH1110Y
60UniProtVAR_058896H1134RDPOG1_HUMANDisease (MTDPS4A)  ---AH1134R
61UniProtVAR_065092E1136KDPOG1_HUMANDisease (MTDPS4A)56047213AE1136K
62UniProtVAR_014908R1142WDPOG1_HUMANPolymorphism2307442AR1142W
63UniProtVAR_014909E1143GDPOG1_HUMANPolymorphism2307441AE1143G
64UniProtVAR_014910R1146CDPOG1_HUMANDisease (PEOB1)2307440AR1146C
65UniProtVAR_023690S1176LDPOG1_HUMANDisease (PEOA1)776031396AS1176L
66UniProtVAR_058897D1184NDPOG1_HUMANDisease (PEOB1)  ---AD1184N
67UniProtVAR_065119D1186HDPOG1_HUMANDisease (PEOA1)  ---AD1186H
68UniProtVAR_058898K1191NDPOG1_HUMANDisease (MTDPS4A)  ---AK1191N
69UniProtVAR_014911Q1236HDPOG1_HUMANPolymorphism3087374AQ1236H

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (69, 71)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_019267R193QDPOG1_HUMANPolymorphism3176162DR193Q
02UniProtVAR_023663R227WDPOG1_HUMANDisease (PEOB1)121918056DR227W
03UniProtVAR_058870R232GDPOG1_HUMANDisease (MTDPS4A)  ---DR232G
04UniProtVAR_058871R232HDPOG1_HUMANDisease (LS)113994093DR232H
05UniProtVAR_058872L244PDPOG1_HUMANDisease (MTDPS4A)  ---DL244P
06UniProtVAR_023664T251IDPOG1_HUMANDisease (PEOB1)113994094DT251I
07UniProtVAR_058873G268ADPOG1_HUMANDisease (PEOB1)61752784DG268A
08UniProtVAR_012154L304RDPOG1_HUMANDisease (PEOB1)121918044DL304R
09UniProtVAR_058875Q308HDPOG1_HUMANDisease (PEOB1)745539599DQ308H
10UniProtVAR_023665R309LDPOG1_HUMANDisease (PEOB1)  ---DR309L
11UniProtVAR_023666W312RDPOG1_HUMANDisease (PEOB1)  ---DW312R
12UniProtVAR_058876G380DDPOG1_HUMANDisease (PEOB1)  ---DG380D
13UniProtVAR_032029G416ADPOG2_HUMANPolymorphism17850455E/FG416A
14UniProtVAR_023667G431VDPOG1_HUMANDisease (PEOB1)  ---DG431V
15UniProtVAR_029364G451EDPOG2_HUMANDisease (PEOA4)104894632E/FG451E
16UniProtVAR_058877L463FDPOG1_HUMANPolymorphism150828914DL463F
17UniProtVAR_012155A467TDPOG1_HUMANDisease (SCAE)113994095DA467T
18UniProtVAR_023668N468DDPOG1_HUMANDisease (PEOB1)145843073DN468D
19UniProtVAR_023669Q497HDPOG1_HUMANDisease (SCAE)121918052DQ497H
20UniProtVAR_058878S511NDPOG1_HUMANDisease (PEOA1)121918055DS511N
21UniProtVAR_058879G517VDPOG1_HUMANDisease (SANDO)61752783DG517V
22UniProtVAR_014906R546CDPOG1_HUMANPolymorphism2307447DR546C
23UniProtVAR_058880R562QDPOG1_HUMANDisease (PEOB1)781168350DR562Q
24UniProtVAR_058881R574WDPOG1_HUMANDisease (PEOB1)774474723DR574W
25UniProtVAR_023670R579WDPOG1_HUMANDisease (PEOB1)556925652DR579W
26UniProtVAR_023671P587LDPOG1_HUMANDisease (PEOB1)113994096DP587L
27UniProtVAR_058882M603LDPOG1_HUMANDisease (PEOB1)  ---DM603L
28UniProtVAR_058883R627QDPOG1_HUMANDisease (SANDO)375305567DR627Q
29UniProtVAR_023672R627WDPOG1_HUMANDisease (SANDO)121918046DR627W
30UniProtVAR_058884P648RDPOG1_HUMANDisease (PEOB1)796052906DP648R
31UniProtVAR_014907E662KDPOG1_HUMANPolymorphism2307450DE662K
32UniProtVAR_058885G737RDPOG1_HUMANDisease (PEOB1)121918054DG737R
33UniProtVAR_023673W748SDPOG1_HUMANDisease (SCAE)113994097DW748S
34UniProtVAR_058886A767DDPOG1_HUMANDisease (MTDPS4A)  ---DA767D
35UniProtVAR_058887R807CDPOG1_HUMANDisease (SANDO)769827124DR807C
36UniProtVAR_058888R807PDPOG1_HUMANDisease (PEOB1)  ---DR807P
37UniProtVAR_023674Y831CDPOG1_HUMANUnclassified (PEOA1)4154971DY831C
38UniProtVAR_023675G848SDPOG1_HUMANDisease (PEOB1)113994098DG848S
39UniProtVAR_058889R853WDPOG1_HUMANDisease (PEOB1)121918053DR853W
40UniProtVAR_023676N864SDPOG1_HUMANDisease (MTDPS4B)121918050DN864S
41UniProtVAR_058890Q879HDPOG1_HUMANDisease (MTDPS4A)  ---DQ879H
42UniProtVAR_058891T885SDPOG1_HUMANDisease (MTDPS4A)  ---DT885S
43UniProtVAR_023677A889TDPOG1_HUMANDisease (PEOB1)763393580DA889T
44UniProtVAR_058892T914PDPOG1_HUMANDisease (MTDPS4A)139590686DT914P
45UniProtVAR_023678G923DDPOG1_HUMANDisease (PEOA1)  ---DG923D
46UniProtVAR_023679H932YDPOG1_HUMANDisease (SANDO)121918048DH932Y
47UniProtVAR_023680R943HDPOG1_HUMANDisease (PEOA1)  ---DR943H
48UniProtVAR_023681R953CDPOG1_HUMANDisease (PEOA1)11546842DR953C
49UniProtVAR_012156Y955CDPOG1_HUMANDisease (PEOA1)113994099DY955C
50UniProtVAR_058893A957PDPOG1_HUMANDisease (MTDPS4A)  ---DA957P
51UniProtVAR_023682A957SDPOG1_HUMANDisease (PEOA1)121918051DA957S
52UniProtVAR_023683R1047QDPOG1_HUMANDisease (PEOB1)768028281DR1047Q
53UniProtVAR_023684G1051RDPOG1_HUMANDisease (SANDO)121918049DG1051R
54UniProtVAR_023686R1096CDPOG1_HUMANDisease (PEOB1)201732356DR1096C
55UniProtVAR_058894R1096HDPOG1_HUMANDisease (MTDPS4A)368435864DR1096H
56UniProtVAR_023687S1104CDPOG1_HUMANDisease (PEOB1)  ---DS1104C
57UniProtVAR_023688A1105TDPOG1_HUMANDisease (PEOB1)753410045DA1105T
58UniProtVAR_023689V1106IDPOG1_HUMANDisease (PEOB1)  ---DV1106I
59UniProtVAR_058895H1110YDPOG1_HUMANDisease (MTDPS4A)  ---DH1110Y
60UniProtVAR_058896H1134RDPOG1_HUMANDisease (MTDPS4A)  ---DH1134R
61UniProtVAR_065092E1136KDPOG1_HUMANDisease (MTDPS4A)56047213DE1136K
62UniProtVAR_014908R1142WDPOG1_HUMANPolymorphism2307442DR1142W
63UniProtVAR_014909E1143GDPOG1_HUMANPolymorphism2307441DE1143G
64UniProtVAR_014910R1146CDPOG1_HUMANDisease (PEOB1)2307440DR1146C
65UniProtVAR_023690S1176LDPOG1_HUMANDisease (PEOA1)776031396DS1176L
66UniProtVAR_058897D1184NDPOG1_HUMANDisease (PEOB1)  ---DD1184N
67UniProtVAR_065119D1186HDPOG1_HUMANDisease (PEOA1)  ---DD1186H
68UniProtVAR_058898K1191NDPOG1_HUMANDisease (MTDPS4A)  ---DK1191N
69UniProtVAR_014911Q1236HDPOG1_HUMANPolymorphism3087374DQ1236H

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1DNA_POLYMERASE_APS00447 DNA polymerase family A signature.DPOG1_HUMAN943-962
 
  2A:943-962
D:943-962
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1DNA_POLYMERASE_APS00447 DNA polymerase family A signature.DPOG1_HUMAN943-962
 
  1A:943-962
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1DNA_POLYMERASE_APS00447 DNA polymerase family A signature.DPOG1_HUMAN943-962
 
  1-
D:943-962

(-) Exons   (0, 0)

(no "Exon" information available for 3IKM)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:1093
 aligned with DPOG1_HUMAN | P54098 from UniProtKB/Swiss-Prot  Length:1239

    Alignment length:1172
                                                                                                                                                                                                                                                                                                                         355                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    
                                                                                                                                                                                                                                                                                                                      354  |                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    
                                    79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349    |  357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667       677       687       697       707       717       727       737       747       757       767       777       787       797       807       817       827       837       847       857       867       877       887       897       907       917       927       937       947       957       967       977       987       997      1007      1017      1027      1037      1047      1057      1067      1077      1087      1097      1107      1117      1127      1137      1147      1157      1167      1177      1187      1197      1207      1217      1227      1237  
         DPOG1_HUMAN     70 RHNPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQKHGLWGQPAVPLPDVELRLPPLYGDNLDQHFRLLAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGPEGEAVPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSQRLVEERYSWTSQLSPADLIPLEVPTGASSPTQRDWQEQLVVGHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQRSLWIAAKQGKHKVQPPTKQGQKSQRKARRGPAISSWDWLDISSVN--SLAEVHRLYVGGPPLEKEPRELFVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLANDACQLLSGERYKEDPWLWDLEWDLQEFKQKKAKKVKKEPATASKLPIEGAGAPGDPMDQEDLGPCSEEEEFQQDVMARACLQKLKGTTELLPKRPQHLPGHPGWYRKLCPRLDDPAWTPGPSLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLVPGRRDNLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQLMPQEAGLAEEFLLTDNSAIWQTVEELDYLEVEAEAKMENLRAAVPGQPLALTARGGPKDTQPSYHHGNGPYNDVDIPGCWFFKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRHPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLEKRSQPGP 1239
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhh........hhhhhhhhhhh...........................hhhhhhhhhhhhhhhhhhhhhhhhhhh..............................................................hhhhhh..................hhhhhh.......................hhhhh..............hhhhhhhh..hhhhhhhhhhhhhh--------------------------..........hhhhhhhhh.......--.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhh................................................hhhhhhhhhhhhhhhhhhhh...........................................................................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.------------------------------------.....hhhhhhhh..............................................hhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhh..............................................hhhhh...........hhhhhh....eeeeeee..hhhhhhhhhhhhhhh....................hhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhh...............hhhhhh....hhhhhh....hhhhhhhhhhhhhh...............---------------..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............eeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhh....eee.....hhhhh......................hhhhhhhhhh........... Sec.struct. author
             SAPs(SNPs) (1) ---------------------------------------------------------------------------------------------------------------------------Q---------------------------------W----G-----------P------I----------------A-----------------------------------R---HL--R---------------------------------------------------------------------D--------------------------------------------------V-------------------------------F---TD----------------------------H-------------N-----V----------------------------C---------------Q-----------W----W-------L---------------L-----------------------Q--------------------R-------------K--------------------------------------------------------------------------R----------S------------------D---------------------------------------C-----------------------C----------------S----W----------S--------------H-----S---T------------------------P--------D--------Y----------H---------C-C-P-----------------------------------------------------------------------------------------Q---R--------------------------------------------C-------CTI---Y-----------------------R-K-----WG--C-----------------------------L-------N-H----N--------------------------------------------H--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------H------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------W-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------P-----------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------------------------------------------------------------------------------------------------------------------H----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DNA_POLYMERASE_A    ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3ikm A   70 RHNPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQKHGLWGQPAVPLPDVELRLPPLYGDNLDQHFRLLAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGPEGEAVPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSQRLVEERYSWTSQLSPADLIPLEVPTGASSPTQRDWQEQLVVGHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQRSLWIAAKQG--------------------------WDWLDISSVNSNSLAEVHRLYVGGPP--KEPRELFVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLANDACQLLSGERYKEDPWLWDLEWDLQEFKQKKAKKVKKEPATASKLPIEGAGAPGDPMDQEDLGPCSEEEEFQQDVMARACLQKLKGTTELLPKRPQHLPGHPGWYRKLCPRLDDPAWTPGPSLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLVPGRRDNLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQLMPQEA------------------------------------AAVPGQPLALTARGGPKDTQPSYHHGNGPYNDVDIPGCWFFKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRHPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPV---------------EEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLEKRSQPGP 1239
                                    79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309        |-         -         -     | 349       359       369|  |   377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667     |   -         -         -         -  |    717       727       737       747       757       767       777       787       797       807       817       827       837       847       857       867       877       887       897       907       917       927       937       947       957       967       977       987       997      1007      1017      1027      1037      1047      1057      1067      |  -         -  |   1097      1107      1117      1127      1137      1147      1157      1167      1177      1187      1197      1207      1217      1227      1237  
                                                                                                                                                                                                                                                                                  318                        345                      370  |                                                                                                                                                                                                                                                                                                           673                                  710                                                                                                                                                                                                                                                                                                                                                                        1074            1090                                                                                                                                                     
                                                                                                                                                                                                                                                                                                                                         371                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    

Chain B from PDB  Type:PROTEIN  Length:355
 aligned with DPOG2_HUMAN | Q9UHN1 from UniProtKB/Swiss-Prot  Length:485

    Alignment length:419
                                    76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476         
         DPOG2_HUMAN     67 EALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV  485
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhh........................hhhhhhhhhhhhhhhhhhh...................-----------------------------------------......hhhhhhhhhhhhhhhhh............ee...----------....ee..........hhhhhhhhhhhhhhhhhhhhh.......eeee...........eeee......eeeeee..............hhhhh.ee....ee......ee.hhhhhhhhhhhhh..-------------........................hhhhhhhhhhhhhhhhhh.................hhhhhhhh................eeee........eeee....hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------A----------------------------------E---------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3ikm B   67 EALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGP-----------------------------------------GKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPV----------KSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQ-------------RKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV  485
                                    76        86        96       106       116       126       136|        -         -         -         -  |    186       196       206       216 |       -  |    236       246       256       266       276       286       296       306       316       326       336       346        |-         -  |    376       386       396       406       416       426       436       446       456       466       476         
                                                                                                137                                       179                                    218        229                                                                                                                           355           369                                                                                                                    

Chain C from PDB  Type:PROTEIN  Length:396
 aligned with DPOG2_HUMAN | Q9UHN1 from UniProtKB/Swiss-Prot  Length:485

    Alignment length:427
                                    68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       
         DPOG2_HUMAN     59 APGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV  485
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhh........hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh..........................-------------------------------......hhhhhhhhhhhhhhhhhhh......eeeeeeee...............eeeeeeee......hhhhhhhhhhhhhhhhhhhhhh.......ee...........ee.eee..eee...........hhhhhh...........................hhhhhhhhhhhhhh..........................eeeee...hhhhhhhhhhhhhhhhhhhh....hhhhhh...hhhhhhhhhhh....eeeee.......................hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------A----------------------------------E---------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3ikm C   59 APGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFR-------------------------------SGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV  485
                                    68        78        88        98       108       118       128       138       | -         -         -       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       
                                                                                                                 146                             178                                                                                                                                                                                                                                                                                                                   

Chain D from PDB  Type:PROTEIN  Length:1094
 aligned with DPOG1_HUMAN | P54098 from UniProtKB/Swiss-Prot  Length:1239

    Alignment length:1170
                                    79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579       589       599       609       619       629       639       649       659       669       679       689       699       709       719       729       739       749       759       769       779       789       799       809       819       829       839       849       859       869       879       889       899       909       919       929       939       949       959       969       979       989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239
         DPOG1_HUMAN     70 RHNPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQKHGLWGQPAVPLPDVELRLPPLYGDNLDQHFRLLAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGPEGEAVPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSQRLVEERYSWTSQLSPADLIPLEVPTGASSPTQRDWQEQLVVGHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQRSLWIAAKQGKHKVQPPTKQGQKSQRKARRGPAISSWDWLDISSVNSLAEVHRLYVGGPPLEKEPRELFVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLANDACQLLSGERYKEDPWLWDLEWDLQEFKQKKAKKVKKEPATASKLPIEGAGAPGDPMDQEDLGPCSEEEEFQQDVMARACLQKLKGTTELLPKRPQHLPGHPGWYRKLCPRLDDPAWTPGPSLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLVPGRRDNLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQLMPQEAGLAEEFLLTDNSAIWQTVEELDYLEVEAEAKMENLRAAVPGQPLALTARGGPKDTQPSYHHGNGPYNDVDIPGCWFFKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRHPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLEKRSQPGP 1239
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...........hhhhhhh........hhhhhhhhhhhhhhh.......................hhhhhhhhhhhhhhhhhhhhhhhhhhh.......................................ee.......ee............hhhhhhhhh.......hhhhh..............................hhhhhhhhh..........hhhhhhhhhhh.hhhhhhhhhhhhh.--------------------------............hhhhhhh...........hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhh...............................................hhhhhhhhhhhhhhhhhhhh...............................hhhhh..hhhhhh................ee..............hhhhhh.......hhhhhhhhhhhhhhhhhhhhh....-----------------------------------......hhhhhh...........................ee...................hhhhhhh.............hhhhhhhhhhhhhhhhhhhhh............hhhhhhh........................................hhhhhhhhhhh....eeeee..hhhhhhhhhhhhhhhhh....................hhhhhhhhhhh....hhhhhhhhhhhh....hhhhhhhhhhhh..hhhhhhhhhhhhhhhhh............hhhhhhhhh.................................hhhhhhhhhhhhhhhh...............---------------...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee..eeeeeee..hhhhhhhhhhhhhhhhhhhhhhhh..............eeee..............hhhhhhhhh......eee.hhhhhhhh............ Sec.struct. author
             SAPs(SNPs) (1) ---------------------------------------------------------------------------------------------------------------------------Q---------------------------------W----G-----------P------I----------------A-----------------------------------R---HL--R-------------------------------------------------------------------D--------------------------------------------------V-------------------------------F---TD----------------------------H-------------N-----V----------------------------C---------------Q-----------W----W-------L---------------L-----------------------Q--------------------R-------------K--------------------------------------------------------------------------R----------S------------------D---------------------------------------C-----------------------C----------------S----W----------S--------------H-----S---T------------------------P--------D--------Y----------H---------C-C-P-----------------------------------------------------------------------------------------Q---R--------------------------------------------C-------CTI---Y-----------------------R-K-----WG--C-----------------------------L-------N-H----N--------------------------------------------H--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------H----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------W-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------P-----------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------------------------------------------------------------------------------------------------------------------H----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DNA_POLYMERASE_A    ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3ikm D   70 RHNPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQKHGLWGQPAVPLPDVELRLPPLYGDNLDQHFRLLAQKQSLPYLEAANLLLQAQLPPKPPAWAWAEGWTRYGPEGEAVPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSQRLVEERYSWTSQLSPADLIPLEVPTGASSPTQRDWQEQLVVGHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQRSLWIAAKQG--------------------------WDWLDISSVNSLAEVHRLYVGGPPLEKEPRELFVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLANDACQLLSGERYKEDPWLWDLEWDLQEFKQKKAKKVKKEPATASKLPIEGAGAPGDPMDQEDLGPCSEEEEFQQDVMARACLQKLKGTTELLPKRPQHLPGHPGWYRKLCPRLDDPAWTPGPSLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLVPGRRDNLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQLMPQEA-----------------------------------RAAVPGQPLALTARGGPKDTQPSYHHGNGPYNDVDIPGCWFFKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRHPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSELKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPV---------------EEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLEKRSQPGP 1239
                                    79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309        |-         -         -     | 349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579       589       599       609       619       629       639       649       659       669   |     -         -         -       709       719       729       739       749       759       769       779       789       799       809       819       829       839       849       859       869       879       889       899       909       919       929       939       949       959       969       979       989       999      1009      1019      1029      1039      1049      1059      1069    |    -         -|     1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239
                                                                                                                                                                                                                                                                                  318                        345                                                                                                                                                                                                                                                                                                                                     673                                 709                                                                                                                                                                                                                                                                                                                                                                         1074            1090                                                                                                                                                     

Chain E from PDB  Type:PROTEIN  Length:355
 aligned with DPOG2_HUMAN | Q9UHN1 from UniProtKB/Swiss-Prot  Length:485

    Alignment length:419
                                    76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476         
         DPOG2_HUMAN     67 EALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV  485
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh........................hhhhhhhhhhhhhhhh......................-----------------------------------------.....hhhhhhhhhhhhhhh....................----------..................hhhhhhhhhhhhhhhhhhhhh.hhh.eeeeee.......eeeeee.........eeeeeee..........hhhhh..hhhhh.....eeeeeehhhhhhhhhh.....-------------...................ee.......hhhhhhhhhhhh...............................eeeeehhhhhh..eeee......eeee...hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------A----------------------------------E---------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3ikm E   67 EALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGP-----------------------------------------GKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPV----------KSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQ-------------RKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV  485
                                    76        86        96       106       116       126       136|        -         -         -         -  |    186       196       206       216 |       -  |    236       246       256       266       276       286       296       306       316       326       336       346        |-         -  |    376       386       396       406       416       426       436       446       456       466       476         
                                                                                                137                                       179                                    218        229                                                                                                                           355           369                                                                                                                    

Chain F from PDB  Type:PROTEIN  Length:396
 aligned with DPOG2_HUMAN | Q9UHN1 from UniProtKB/Swiss-Prot  Length:485

    Alignment length:427
                                    68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       
         DPOG2_HUMAN     59 APGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV  485
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhh........hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.........................-------------------------------......hhhhhhhhhhhhhhhhhhh......eeeeeeee...............eeeeeeee.......hhhhhhhhhhhhhhhhhhhhh.hhhhh.ee...........ee.eee..eee..........hhhhhhh...........................hhhhhhhhhhhhhh..........................eeeee...hhhhhhhhhhhhhhhhhhhh....hhhhhhh..hhhhhhhhhhh....eeeee.......................hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------A----------------------------------E---------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3ikm F   59 APGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFR-------------------------------SGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV  485
                                    68        78        88        98       108       118       128       138       | -         -         -       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       
                                                                                                                 146                             178                                                                                                                                                                                                                                                                                                                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3IKM)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3IKM)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3IKM)

(-) Gene Ontology  (38, 49)

Asymmetric Unit(hide GO term definitions)
Chain A,D   (DPOG1_HUMAN | P54098)
molecular function
    GO:0008408    3'-5' exonuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids by removing nucleotide residues from the 3' end.
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003887    DNA-directed DNA polymerase activity    Catalysis of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1); the synthesis of DNA from deoxyribonucleotide triphosphates in the presence of a DNA template and a 3'hydroxyl group.
    GO:0003682    chromatin binding    Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0002020    protease binding    Interacting selectively and non-covalently with any protease or peptidase.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0071897    DNA biosynthetic process    The cellular DNA metabolic process resulting in the formation of DNA, deoxyribonucleic acid, one of the two main types of nucleic acid, consisting of a long unbranched macromolecule formed from one or two strands of linked deoxyribonucleotides, the 3'-phosphate group of each constituent deoxyribonucleotide being joined in 3',5'-phosphodiester linkage to the 5'-hydroxyl group of the deoxyribose moiety of the next one.
    GO:0006259    DNA metabolic process    Any cellular metabolic process involving deoxyribonucleic acid. This is one of the two main types of nucleic acid, consisting of a long, unbranched macromolecule formed from one, or more commonly, two, strands of linked deoxyribonucleotides.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0006261    DNA-dependent DNA replication    A DNA replication process that uses parental DNA as a template for the DNA-dependent DNA polymerases that synthesize the new strands.
    GO:0007568    aging    A developmental process that is a deterioration and loss of function over time. Aging includes loss of functions such as resistance to disease, homeostasis, and fertility, as well as wear and tear. Aging includes cellular senescence, but is more inclusive. May precede death and may succeed developmental maturation (GO:0021700).
    GO:0006287    base-excision repair, gap-filling    Repair of the damaged strand by the combined action of an apurinic endouclease that degrades a few bases on the damaged strand and a polymerase that synthesizes a 'patch' in the 5' to 3' direction, using the undamaged strand as a template.
    GO:0071333    cellular response to glucose stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucose stimulus.
    GO:0006264    mitochondrial DNA replication    The process in which new strands of DNA are synthesized in the mitochondrion.
    GO:0090305    nucleic acid phosphodiester bond hydrolysis    The nucleic acid metabolic process in which the phosphodiester bonds between nucleotides are cleaved by hydrolysis.
    GO:0010332    response to gamma radiation    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a gamma radiation stimulus. Gamma radiation is a form of electromagnetic radiation (EMR) or light emission of a specific frequency produced from sub-atomic particle interaction, such as electron-positron annihilation and radioactive decay. Gamma rays are generally characterized as EMR having the highest frequency and energy, and also the shortest wavelength, within the electromagnetic radiation spectrum.
    GO:0055093    response to hyperoxia    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating increased oxygen tension.
    GO:0009416    response to light stimulus    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a light stimulus, electromagnetic radiation of wavelengths classified as infrared, visible or ultraviolet light.
cellular component
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005760    gamma DNA polymerase complex    A DNA polymerase complex consisting of a large subunit, responsible for the catalytic activities, and a small accessory subunit. Functions in the replication and repair of mitochondrial DNA.
    GO:0042645    mitochondrial nucleoid    The region of a mitochondrion to which the DNA is confined.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
    GO:0043195    terminal bouton    Terminal inflated portion of the axon, containing the specialized apparatus necessary to release neurotransmitters. The axon terminus is considered to be the whole region of thickening and the terminal bouton is a specialized region of it.

Chain B,C,E,F   (DPOG2_HUMAN | Q9UHN1)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003887    DNA-directed DNA polymerase activity    Catalysis of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1); the synthesis of DNA from deoxyribonucleotide triphosphates in the presence of a DNA template and a 3'hydroxyl group.
    GO:0004820    glycine-tRNA ligase activity    Catalysis of the reaction: ATP + glycine + tRNA(Gly) = AMP + diphosphate + glycyl-tRNA(Gly).
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0071897    DNA biosynthetic process    The cellular DNA metabolic process resulting in the formation of DNA, deoxyribonucleic acid, one of the two main types of nucleic acid, consisting of a long unbranched macromolecule formed from one or two strands of linked deoxyribonucleotides, the 3'-phosphate group of each constituent deoxyribonucleotide being joined in 3',5'-phosphodiester linkage to the 5'-hydroxyl group of the deoxyribose moiety of the next one.
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0006261    DNA-dependent DNA replication    A DNA replication process that uses parental DNA as a template for the DNA-dependent DNA polymerases that synthesize the new strands.
    GO:0006426    glycyl-tRNA aminoacylation    The process of coupling glycine to glycyl-tRNA, catalyzed by glycyl-tRNA synthetase. In tRNA aminoacylation, the amino acid is first activated by linkage to AMP and then transferred to either the 2'- or the 3'-hydroxyl group of the 3'-adenosine residue of the tRNA.
    GO:0001701    in utero embryonic development    The process whose specific outcome is the progression of the embryo in the uterus over time, from formation of the zygote in the oviduct, to birth. An example of this process is found in Mus musculus.
    GO:0032042    mitochondrial DNA metabolic process    The chemical reactions and pathways involving mitochondrial DNA.
    GO:0070584    mitochondrion morphogenesis    The process in which the anatomical structures of a mitochondrion are generated and organized.
    GO:0007005    mitochondrion organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a mitochondrion; includes mitochondrial morphogenesis and distribution, and replication of the mitochondrial genome as well as synthesis of new mitochondrial components.
    GO:0022904    respiratory electron transport chain    A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
cellular component
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0000262    mitochondrial chromosome    A chromosome found in the mitochondrion of a eukaryotic cell.
    GO:0005759    mitochondrial matrix    The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
    GO:0042645    mitochondrial nucleoid    The region of a mitochondrion to which the DNA is confined.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3ikm)
 
  Sites
(no "Sites" information available for 3ikm)
 
  Cis Peptide Bonds
    Asn A:1202 - Pro A:1203   [ RasMol ]  
    Gly A:724 - Pro A:725   [ RasMol ]  
    Gly B:390 - Pro B:391   [ RasMol ]  
    Gly C:390 - Pro C:391   [ RasMol ]  
    Gly D:724 - Pro D:725   [ RasMol ]  
    Gly F:390 - Pro F:391   [ RasMol ]  
    His E:375 - Pro E:376   [ RasMol ]  
    Leu A:634 - Pro A:635   [ RasMol ]  
    Leu A:752 - Pro A:753   [ RasMol ]  
    Leu B:204 - Pro B:205   [ RasMol ]  
    Leu D:566 - Pro D:567   [ RasMol ]  
    Leu D:752 - Pro D:753   [ RasMol ]  
    Leu D:821 - Pro D:822   [ RasMol ]  
    Leu E:204 - Pro E:205   [ RasMol ]  
    Met D:669 - Pro D:670   [ RasMol ]  
    Pro D:368 - Leu D:369   [ RasMol ]  
    Ser A:255 - Pro A:256   [ RasMol ]  
    Ser D:216 - Pro D:217   [ RasMol ]  
    Ser D:255 - Pro D:256   [ RasMol ]  
    Thr A:1199 - Pro A:1200   [ RasMol ]  
    Thr D:1199 - Pro D:1200   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3ikm
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DPOG1_HUMAN | P54098
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  DPOG2_HUMAN | Q9UHN1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.7.7
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  157640
    Disease InformationOMIM
  203700
    Disease InformationOMIM
  256000
    Disease InformationOMIM
  258450
    Disease InformationOMIM
  607459
    Disease InformationOMIM
  610131
    Disease InformationOMIM
  613662
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  DPOG1_HUMAN | P54098
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  DPOG2_HUMAN | Q9UHN1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DPOG1_HUMAN | P540984ztu 4ztz 5c51 5c52 5c53
        DPOG2_HUMAN | Q9UHN12g4c 3ikl 4ztu 4ztz 5c51 5c52 5c53

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3IKM)