Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF NEDD8-ACTIVATING ENZYME IN COMPLEX WITH NEDD8 AND MLN4924
 
Authors :  M. D. Sintchak
Date :  07 Apr 09  (Deposition) - 02 Feb 10  (Release) - 21 Mar 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym. Unit :  A,B,C,D,I,J
Biol. Unit 1:  A,B,I  (1x)
Biol. Unit 2:  C,D,J  (1x)
Keywords :  Nedd8, E1-Activating Enzyme, Mln4924, Protein Binding-Ligase Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. E. Brownell, M. D. Sintchak, J. M. Gavin, H. Liao, F. J. Bruzzese, N. J. Bump, T. A. Soucy, M. A. Milhollen, X. Yang, A. L. Burkhardt, J. Ma, H. K. Loke, T. Lingaraj, D. Wu, K. B. Hamman, J. J. Spelman, C. A. Cullis, S. P. Langston, S. Vyskocil, T. B. Sells, W. D. Mallender, I. Visiers, P. Li, C. F. Claiborne, M. Rolfe, J. B. Bolen, L. R. Dick
Substrate-Assisted Inhibition Of Ubiquitin-Like Protein-Activating Enzymes: The Nedd8 E1 Inhibitor Mln4924 Forms A Nedd8-Amp Mimetic In Situ.
Mol. Cell V. 37 102 2010
PubMed-ID: 20129059  |  Reference-DOI: 10.1016/J.MOLCEL.2009.12.024

(-) Compounds

Molecule 1 - NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    ChainsA, C
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System StrainSF9
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    GeneAPPBP1, HPP1, NAE1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymAMYLOID PROTEIN-BINDING PROTEIN 1, AMYLOID BETA PRECURSOR PROTEIN-BINDING PROTEIN 1, 59 KDA, APP-BP1, PROTO-ONCOGENE PROTEIN 1
 
Molecule 2 - NEDD8-ACTIVATING ENZYME E1 CATALYTIC SUBUNIT
    ChainsB, D
    EC Number6.3.2.-
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System StrainSF9
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    GeneUBA3, UBE1C
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymUBIQUITIN-LIKE MODIFIER-ACTIVATING ENZYME 3, UBIQUITIN- ACTIVATING ENZYME 3, NEDD8-ACTIVATING ENZYME E1C, UBIQUITIN- ACTIVATING ENZYME E1C
 
Molecule 3 - NEDD8
    ChainsI, J
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System StrainSF9
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    GeneNEDD8
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymUBIQUITIN-LIKE PROTEIN NEDD8, NEDDYLIN, NEURAL PRECURSOR CELL EXPRESSED DEVELOPMENTALLY DOWN-REGULATED PROTEIN 8, NEDD-8

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit ABCDIJ
Biological Unit 1 (1x)AB  I 
Biological Unit 2 (1x)  CD J

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric Unit (2, 4)
No.NameCountTypeFull Name
1B392Ligand/Ion[(1S,2S,4R)-4-{4-[(1S)-2,3-DIHYDRO-1H-INDEN-1-YLAMINO]-7H-PYRROLO[2,3-D]PYRIMIDIN-7-YL}-2-HYDROXYCYCLOPENTYL]METHYL SULFAMATE
2ZN2Ligand/IonZINC ION
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1B391Ligand/Ion[(1S,2S,4R)-4-{4-[(1S)-2,3-DIHYDRO-1H-INDEN-1-YLAMINO]-7H-PYRROLO[2,3-D]PYRIMIDIN-7-YL}-2-HYDROXYCYCLOPENTYL]METHYL SULFAMATE
2ZN-1Ligand/IonZINC ION
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1B391Ligand/Ion[(1S,2S,4R)-4-{4-[(1S)-2,3-DIHYDRO-1H-INDEN-1-YLAMINO]-7H-PYRROLO[2,3-D]PYRIMIDIN-7-YL}-2-HYDROXYCYCLOPENTYL]METHYL SULFAMATE
2ZN-1Ligand/IonZINC ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY D:78 , GLY D:79 , ASP D:100 , MET D:101 , ARG D:111 , GLN D:112 , LYS D:124 , ASN D:146 , LYS D:147 , ILE D:148 , GLN D:149 , GLY D:165 , ASP D:167 , ALA D:171 , TRP D:174 , GLY J:76BINDING SITE FOR RESIDUE B39 J 464
2AC2SOFTWAREGLY B:78 , GLY B:79 , ASP B:100 , MET B:101 , ASP B:102 , ARG B:111 , GLN B:112 , LYS B:124 , ASN B:146 , LYS B:147 , ILE B:148 , GLN B:149 , ASP B:167 , ALA B:171 , TRP B:174 , GLY I:76BINDING SITE FOR RESIDUE B39 I 464
3AC3SOFTWARECYS B:220 , CYS B:223 , CYS B:364 , CYS B:367BINDING SITE FOR RESIDUE ZN B 465
4AC4SOFTWARECYS D:220 , CYS D:223 , CYS D:364 , CYS D:367BINDING SITE FOR RESIDUE ZN D 465

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3GZN)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3GZN)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 2)

Asymmetric Unit (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052435S101FULA1_HUMANPolymorphism363212A/CS108F

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052435S101FULA1_HUMANPolymorphism363212AS108F

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052435S101FULA1_HUMANPolymorphism363212CS108F

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 6)

Asymmetric Unit (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_2PS50053 Ubiquitin domain profile.NEDD8_HUMAN1-76
 
  2I:1-76
J:1-76
2UBIQUITIN_1PS00299 Ubiquitin domain signature.NEDD8_HUMAN27-52
 
  2I:27-52
J:27-52
3UBIQUITIN_ACTIVAT_2PS00865 Ubiquitin-activating enzyme active site.UBA3_HUMAN235-243
 
  2B:235-243
D:235-243
Biological Unit 1 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_2PS50053 Ubiquitin domain profile.NEDD8_HUMAN1-76
 
  1I:1-76
-
2UBIQUITIN_1PS00299 Ubiquitin domain signature.NEDD8_HUMAN27-52
 
  1I:27-52
-
3UBIQUITIN_ACTIVAT_2PS00865 Ubiquitin-activating enzyme active site.UBA3_HUMAN235-243
 
  1B:235-243
-
Biological Unit 2 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_2PS50053 Ubiquitin domain profile.NEDD8_HUMAN1-76
 
  1-
J:1-76
2UBIQUITIN_1PS00299 Ubiquitin domain signature.NEDD8_HUMAN27-52
 
  1-
J:27-52
3UBIQUITIN_ACTIVAT_2PS00865 Ubiquitin-activating enzyme active site.UBA3_HUMAN235-243
 
  1-
D:235-243

(-) Exons   (40, 80)

Asymmetric Unit (40, 80)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002504951aENSE00001101093chr14:24701660-24701456205NEDD8_HUMAN1-662I:1-6
J:1-6
6
6
1.4ENST000002504954ENSE00002175755chr14:24687637-2468759048NEDD8_HUMAN7-22162I:7-22
J:7-22
16
16
1.5aENST000002504955aENSE00002178617chr14:24687421-2468733983NEDD8_HUMAN23-50282I:23-50
J:23-50
28
28
1.6eENST000002504956eENSE00001549615chr14:24686429-24686058372NEDD8_HUMAN50-81322I:50-76
J:50-76
27
27

2.1aENST000002908101aENSE00001857882chr16:66864900-66864750151ULA1_HUMAN1-18182A:15-25
C:14-25
11
12
2.3aENST000002908103aENSE00001739042chr16:66860683-66860580104ULA1_HUMAN18-53362A:25-60
C:25-60
36
36
2.4ENST000002908104ENSE00001779668chr16:66860486-6686042661ULA1_HUMAN53-73212A:60-80
C:60-80
21
21
2.5ENST000002908105ENSE00001624314chr16:66858788-6685875831ULA1_HUMAN73-83112A:80-90
C:80-90
11
11
2.6ENST000002908106ENSE00001761968chr16:66857503-6685743272ULA1_HUMAN84-107242A:91-114
C:91-114
24
24
2.7ENST000002908107ENSE00001104193chr16:66857209-6685713080ULA1_HUMAN108-134272A:115-141
C:115-141
27
27
2.8ENST000002908108ENSE00001104205chr16:66855462-66855353110ULA1_HUMAN134-171382A:141-178
C:141-178
38
38
2.9ENST000002908109ENSE00001104202chr16:66852540-66852431110ULA1_HUMAN171-207372A:178-214
C:178-214
37
37
2.10ENST0000029081010ENSE00001104208chr16:66851390-6685132863ULA1_HUMAN208-228212A:215-235
C:215-235
21
21
2.11ENST0000029081011ENSE00001104214chr16:66850931-6685086864ULA1_HUMAN229-250222A:236-257
C:236-257 (gaps)
22
22
2.12ENST0000029081012ENSE00001104186chr16:66850575-6685048492ULA1_HUMAN250-280312A:257-287
C:257-287
31
31
2.13ENST0000029081013ENSE00001139971chr16:66847749-6684769060ULA1_HUMAN281-300202A:288-307
C:288-307
20
20
2.14ENST0000029081014ENSE00001139961chr16:66847600-66847467134ULA1_HUMAN301-345452A:308-352
C:308-352
45
45
2.15ENST0000029081015ENSE00001139952chr16:66844675-6684460076ULA1_HUMAN345-370262A:352-377
C:352-377
26
26
2.16ENST0000029081016ENSE00001046614chr16:66844316-6684427740ULA1_HUMAN371-384142A:378-391
C:378-391
14
14
2.17ENST0000029081017ENSE00001046603chr16:66842978-6684289287ULA1_HUMAN384-413302A:391-420
C:391-420
30
30
2.18ENST0000029081018ENSE00001046627chr16:66842516-6684242493ULA1_HUMAN413-444322A:420-451
C:420-451
32
32
2.19ENST0000029081019ENSE00001104192chr16:66839929-66839815115ULA1_HUMAN444-482392A:451-489
C:451-489
39
39
2.20ENST0000029081020ENSE00001104217chr16:66839729-6683968050ULA1_HUMAN482-499182A:489-506
C:489-506
18
18
2.21bENST0000029081021bENSE00001907559chr16:66837021-66836778244ULA1_HUMAN499-534362A:506-541
C:506-541
36
36

3.1aENST000003610551aENSE00001864869chr3:69129559-6912948575UBA3_HUMAN1-770--
3.2aENST000003610552aENSE00001417479chr3:69129304-6912926342UBA3_HUMAN7-21150--
3.3aENST000003610553aENSE00000966869chr3:69127069-69126949121UBA3_HUMAN21-61412B:33-61
D:33-61
29
29
3.4aENST000003610554aENSE00001377164chr3:69124661-6912458181UBA3_HUMAN62-88272B:62-88
D:62-88
27
27
3.5aENST000003610555aENSE00001376644chr3:69120768-6912068683UBA3_HUMAN89-116282B:89-116
D:89-116
28
28
3.6ENST000003610556ENSE00000966872chr3:69117159-6911707981UBA3_HUMAN116-143282B:116-143
D:116-143
28
28
3.7aENST000003610557aENSE00000966873chr3:69113262-6911321944UBA3_HUMAN143-158162B:143-158
D:143-158
16
16
3.8ENST000003610558ENSE00000966874chr3:69112654-6911259065UBA3_HUMAN158-179222B:158-179
D:158-179
22
22
3.9ENST000003610559ENSE00000966875chr3:69112288-69112133156UBA3_HUMAN180-231522B:180-231
D:180-231
52
52
3.10ENST0000036105510ENSE00000966876chr3:69111330-69111228103UBA3_HUMAN232-266352B:232-266
D:232-266
35
35
3.11aENST0000036105511aENSE00000966877chr3:69111078-69110965114UBA3_HUMAN266-304392B:266-304
D:266-304
39
39
3.12ENST0000036105512ENSE00000966878chr3:69106460-6910640754UBA3_HUMAN304-322192B:304-322
D:304-322
19
19
3.13ENST0000036105513ENSE00001656120chr3:69105966-6910593037UBA3_HUMAN322-334132B:322-334
D:322-334
13
13
3.14ENST0000036105514ENSE00001685710chr3:69105844-6910576382UBA3_HUMAN334-361282B:334-361
D:334-361
28
28
3.15ENST0000036105515ENSE00001754233chr3:69105434-69105334101UBA3_HUMAN362-395342B:362-395
D:362-395
34
34
3.16ENST0000036105516ENSE00001711956chr3:69105214-6910515164UBA3_HUMAN395-416222B:395-416
D:395-416
22
22
3.17ENST0000036105517ENSE00001673741chr3:69105056-6910500255UBA3_HUMAN417-435192B:417-435 (gaps)
D:417-435 (gaps)
19
19
3.18bENST0000036105518bENSE00001518240chr3:69104676-69103881796UBA3_HUMAN435-463292B:435-462
D:435-462
28
28

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:527
 aligned with ULA1_HUMAN | Q13564 from UniProtKB/Swiss-Prot  Length:534

    Alignment length:527
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       
           ULA1_HUMAN     8 LKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNALEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPDNEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVHEFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL 534
               SCOP domains d3gzna_ A: Amyloid beta precursor protein-binding protein 1, APPBP1                                                                                                                                                                                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 3gznA01 A:15-185,A:395-541 NAD(P)-binding Rossmann-like Domain                                                                                                             -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3gznA01 A:15-185,A:395-541 NAD(P)-binding Rossmann-like Domain                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhh.eeeee..hhhhhhhhhhhhh....eeeee.....hhhhhhhh...hhhhh..hhhhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhhh.eeeee..hhhhhhhhhhhhhhh...eeeeeee..eeeeeee...eee.................hhhhhhhhhh..............hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh...........hhhhhhhhhhh.........hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh.eee...hhhhhhh....hhhhhhhhhh....hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......eeeee....eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------F------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.1a  ----------------------------------Exon 2.4  PDB: A:60-8----------Exon 2.6  PDB: A:91-114 Exon 2.7  PDB: A:115-141   ------------------------------------Exon 2.9  PDB: A:178-214             Exon 2.10            Exon 2.11             ------------------------------Exon 2.13           Exon 2.14  PDB: A:308-352 UniProt: 301-345   -------------------------Exon 2.16     ----------------------------Exon 2.18  PDB: A:420-451       -------------------------------------Exon 2.20         ----------------------------------- Transcript 2 (1)
           Transcript 2 (2) ----------Exon 2.3a  PDB: A:25-60             -------------------Exon 2.5   --------------------------------------------------Exon 2.8  PDB: A:141-178              ------------------------------------------------------------------------------Exon 2.12  PDB: A:257-287      ----------------------------------------------------------------Exon 2.15  PDB: A:352-377 -------------Exon 2.17  PDB: A:391-420     ------------------------------Exon 2.19  PDB: A:451-489              ----------------Exon 2.21b  PDB: A:506-541           Transcript 2 (2)
                 3gzn A  15 LKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNALEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPDNEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVHEFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL 541
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       

Chain B from PDB  Type:PROTEIN  Length:429
 aligned with UBA3_HUMAN | Q8TBC4 from UniProtKB/Swiss-Prot  Length:463

    Alignment length:430
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462
           UBA3_HUMAN    33 DWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFT 462
               SCOP domains d3gznb_ B: UBA3                                                                                                                                                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains 3gznB01 B:33-230,B:310-360 NAD(P)-binding Rossmann-like Domain                                                                                                                                        --3gznB02 B:233-309 Ubiquitin activating enzymes (Uba3). Chain: B, domain 2    3gznB01 B:33-230,B:310-360                         3gznB03 B:361-421                                            ----------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhh.............hhhhhhhhhheeeee..hhhhhhhhhhhhh....eeeee.....hhhhhhh....hhhhh..hhhhhhhhhhhhhh...eeeee.......hhhhhh...eeeee..hhhhhhhhhhhhhhh..ee..ee.hhhh..eeeeeee..eeeeeee..........hhhhh......hhhhhhhh..hhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.......eeeee.....eeeee...............eeeee.....hhhhhhhhhhh........eeeee....eeeee.....hhhhhhhhhhh.-..........eeeeee..eeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------UBIQUITIN--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 3 (1) Exon 3.3a  PDB: B:33-61      Exon 3.4a  PDB: B:62-88    Exon 3.5a  PDB: B:89-116    --------------------------Exon 3.7a       ---------------------Exon 3.9  PDB: B:180-231 UniProt: 180-231           Exon 3.10  PDB: B:232-266          -------------------------------------Exon 3.12          -----------Exon 3.14  PDB: B:334-361   Exon 3.15  PDB: B:362-395         ---------------------Exon 3.17          --------------------------- Transcript 3 (1)
           Transcript 3 (2) -----------------------------------------------------------------------------------Exon 3.6  PDB: B:116-143    --------------Exon 3.8              --------------------------------------------------------------------------------------Exon 3.11a  PDB: B:266-304             -----------------Exon 3.13    ------------------------------------------------------------Exon 3.16             ------------------Exon 3.18b  PDB: B:435-462   Transcript 3 (2)
                 3gzn B  33 DWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTRPNLSK-LKELGLVDGQELAVADVTTPQTVLFKLHFT 462
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422        |-|      442       452       462
                                                                                                                                                                                                                                                                                                                                                                                                                                        431 |                             
                                                                                                                                                                                                                                                                                                                                                                                                                                          433                             

Chain C from PDB  Type:PROTEIN  Length:526
 aligned with ULA1_HUMAN | Q13564 from UniProtKB/Swiss-Prot  Length:534

    Alignment length:528
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526        
           ULA1_HUMAN     7 LLKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNALEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPDNEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVHEFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL 534
               SCOP domains d3gznc_ C: Amyloid beta precursor protein-binding protein 1, APPBP1                                                                                                                                                                                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 3gznC01 C:14-185,C:395-541 NAD(P)-binding Rossmann-like Domain                                                                                                              -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3gznC01 C:14-185,C:395-541 NAD(P)-binding Rossmann-like Domain                                                                                      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhh.eeeee..hhhhhhhhhhhhh....eeeee.....hhhhhhhh...hhhhh..hhhhhhhhhhhh.....eeeee..hhhhhhhhhhhhhhhh.eeeee..hhhhhhhhhhhhhhh...eeeeeee..eeeeeee...eee.................hhhhhhhhhh.hhhhh.hhhhhh.hhhhhhhhhhhhhhhh.--....hhhhhhhhhhhhhhh...........hhhhhhhhhhhhh.......hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh....eee...hhhhhhh....hhhhhhhhh.....hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......eeeee....eeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------F------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 2 (1) Exon 2.1a   ----------------------------------Exon 2.4  PDB: C:60-8----------Exon 2.6  PDB: C:91-114 Exon 2.7  PDB: C:115-141   ------------------------------------Exon 2.9  PDB: C:178-214             Exon 2.10            Exon 2.11             ------------------------------Exon 2.13           Exon 2.14  PDB: C:308-352 UniProt: 301-345   -------------------------Exon 2.16     ----------------------------Exon 2.18  PDB: C:420-451       -------------------------------------Exon 2.20         ----------------------------------- Transcript 2 (1)
           Transcript 2 (2) -----------Exon 2.3a  PDB: C:25-60             -------------------Exon 2.5   --------------------------------------------------Exon 2.8  PDB: C:141-178              ------------------------------------------------------------------------------Exon 2.12  PDB: C:257-287      ----------------------------------------------------------------Exon 2.15  PDB: C:352-377 -------------Exon 2.17  PDB: C:391-420     ------------------------------Exon 2.19  PDB: C:451-489              ----------------Exon 2.21b  PDB: C:506-541           Transcript 2 (2)
                 3gzn C  14 LLKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNALEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSET--RIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPDNEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVHEFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL 541
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233  |  | 243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533        
                                                                                                                                                                                                                                                        236  |                                                                                                                                                                                                                                                                                                              
                                                                                                                                                                                                                                                           239                                                                                                                                                                                                                                                                                                              

Chain D from PDB  Type:PROTEIN  Length:429
 aligned with UBA3_HUMAN | Q8TBC4 from UniProtKB/Swiss-Prot  Length:463

    Alignment length:430
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462
           UBA3_HUMAN    33 DWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFT 462
               SCOP domains d3gznd_ D: UBA3                                                                                                                                                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains 3gznD01 D:33-230,D:310-360 NAD(P)-binding Rossmann-like Domain                                                                                                                                        --3gznD02 D:233-309 Ubiquitin activating enzymes (Uba3). Chain: B, domain 2    3gznD01 D:33-230,D:310-360                         3gznD03 D:361-421                                            ----------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhh............hhhhhhhhhhheeeee..hhhhhhhhhhhhh....eeeeee....hhhhhhh....hhhhh..hhhhhhhhhhhhhh...eeeeee.hhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhhhh.ee..ee.hhhh..eeeeeee..eeeeeee.......hhhhhhhh......hhhhhhh...hhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.......eeeee.....eeeee...............eeeee.....hhhhhhhhhhh........eeeee....eeeee...hhhhhhhhhhhhh.-..........eeeeee..eeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------UBIQUITIN--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 3 (1) Exon 3.3a  PDB: D:33-61      Exon 3.4a  PDB: D:62-88    Exon 3.5a  PDB: D:89-116    --------------------------Exon 3.7a       ---------------------Exon 3.9  PDB: D:180-231 UniProt: 180-231           Exon 3.10  PDB: D:232-266          -------------------------------------Exon 3.12          -----------Exon 3.14  PDB: D:334-361   Exon 3.15  PDB: D:362-395         ---------------------Exon 3.17          --------------------------- Transcript 3 (1)
           Transcript 3 (2) -----------------------------------------------------------------------------------Exon 3.6  PDB: D:116-143    --------------Exon 3.8              --------------------------------------------------------------------------------------Exon 3.11a  PDB: D:266-304             -----------------Exon 3.13    ------------------------------------------------------------Exon 3.16             ------------------Exon 3.18b  PDB: D:435-462   Transcript 3 (2)
                 3gzn D  33 DWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTRPNLSK-LKELGLVDGQELAVADVTTPQTVLFKLHFT 462
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422        |-|      442       452       462
                                                                                                                                                                                                                                                                                                                                                                                                                                        431 |                             
                                                                                                                                                                                                                                                                                                                                                                                                                                          433                             

Chain I from PDB  Type:PROTEIN  Length:79
 aligned with NEDD8_HUMAN | Q15843 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:79
                               1                                                                           
                               |     7        17        27        37        47        57        67         
          NEDD8_HUMAN     - ---MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG  76
               SCOP domains d3gzni_ I: Nedd8                                                                SCOP domains
               CATH domains ------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee.....eeeeee....hhhhhhhhhhhhhh.hhhhh.eee..ee......hhhhh.....eeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---UBIQUITIN_2  PDB: I:1-76 UniProt: 1-76                                       PROSITE (1)
                PROSITE (2) -----------------------------UBIQUITIN_1  PDB: I:27-52 ------------------------ PROSITE (2)
           Transcript 1 (1) ---1.1a  Exon 1.4        Exon 1.5a  PDB: I:23-50     -------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.6e  PDB: I:50-76     Transcript 1 (2)
                 3gzn I  -2 HHHMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG  76
                                     7        17        27        37        47        57        67         

Chain J from PDB  Type:PROTEIN  Length:79
 aligned with NEDD8_HUMAN | Q15843 from UniProtKB/Swiss-Prot  Length:81

    Alignment length:79
                               1                                                                           
                               |     7        17        27        37        47        57        67         
          NEDD8_HUMAN     - ---MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG  76
               SCOP domains d3gznj_ J: Nedd8                                                                SCOP domains
               CATH domains ------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee.....eeeeee....hhhhhhhhhhhhhh.hhhhh.eee..ee......hhhhh.....eeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---UBIQUITIN_2  PDB: J:1-76 UniProt: 1-76                                       PROSITE (1)
                PROSITE (2) -----------------------------UBIQUITIN_1  PDB: J:27-52 ------------------------ PROSITE (2)
           Transcript 1 (1) ---1.1a  Exon 1.4        Exon 1.5a  PDB: J:23-50     -------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.6e  PDB: J:50-76     Transcript 1 (2)
                 3gzn J  -2 HHHMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG  76
                                     7        17        27        37        47        57        67         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 6)

Asymmetric Unit

(-) CATH Domains  (3, 8)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3GZN)

(-) Gene Ontology  (37, 52)

Asymmetric Unit(hide GO term definitions)
Chain A,C   (ULA1_HUMAN | Q13564)
molecular function
    GO:0019781    NEDD8 activating enzyme activity    Catalysis of the initiation of the NEDD8 (RUB1) conjugation cascade.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0008641    small protein activating enzyme activity    Catalysis of the activation of small proteins, such as ubiquitin or ubiquitin-like proteins, through the formation of an ATP-dependent high-energy thiolester bond.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0033314    mitotic DNA replication checkpoint    A cell cycle checkpoint that acts during a mitotic cell cycle and prevents the initiation of mitosis until DNA replication is complete, thereby ensuring that progeny inherit a full complement of the genome.
    GO:0051402    neuron apoptotic process    Any apoptotic process in a neuron, the basic cellular unit of nervous tissue. Each neuron consists of a body, an axon, and dendrites. Their purpose is to receive, conduct, and transmit impulses in the nervous system.
    GO:0045116    protein neddylation    Covalent attachment of the ubiquitin-like protein NEDD8 (RUB1) to another protein.
    GO:0042981    regulation of apoptotic process    Any process that modulates the occurrence or rate of cell death by apoptotic process.
    GO:0043523    regulation of neuron apoptotic process    Any process that modulates the occurrence or rate of cell death by apoptotic process in neurons.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain B,D   (UBA3_HUMAN | Q8TBC4)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0019781    NEDD8 activating enzyme activity    Catalysis of the initiation of the NEDD8 (RUB1) conjugation cascade.
    GO:0016881    acid-amino acid ligase activity    Catalysis of the ligation of an acid to an amino acid via a carbon-nitrogen bond, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0016922    ligand-dependent nuclear receptor binding    Interacting selectively and non-covalently, in a ligand dependent manner, with a nuclear receptor protein.
    GO:0016874    ligase activity    Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0008641    small protein activating enzyme activity    Catalysis of the activation of small proteins, such as ubiquitin or ubiquitin-like proteins, through the formation of an ATP-dependent high-energy thiolester bond.
biological process
    GO:0038061    NIK/NF-kappaB signaling    The process in which a signal is passed on to downstream components within the cell through the NIK-dependent processing and activation of NF-KappaB. Begins with activation of the NF-KappaB-inducing kinase (NIK), which in turn phosphorylates and activates IkappaB kinase alpha (IKKalpha). IKKalpha phosphorylates the NF-Kappa B2 protein (p100) leading to p100 processing and release of an active NF-KappaB (p52).
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0006464    cellular protein modification process    The covalent alteration of one or more amino acids occurring in proteins, peptides and nascent polypeptides (co-translational, post-translational modifications) occurring at the level of an individual cell. Includes the modification of charged tRNAs that are destined to occur in a protein (pre-translation modification).
    GO:0007113    endomitotic cell cycle    A mitotic cell cycle in which chromosomes are replicated and sister chromatids separate, but spindle formation, nuclear membrane breakdown and nuclear division do not occur, resulting in an increased number of chromosomes in the cell.
    GO:0000278    mitotic cell cycle    Progression through the phases of the mitotic cell cycle, the most common eukaryotic cell cycle, which canonically comprises four successive phases called G1, S, G2, and M and includes replication of the genome and the subsequent segregation of chromosomes into daughter cells. In some variant cell cycles nuclear replication or nuclear division may not be followed by cell division, or G1 and G2 phases may be absent.
    GO:0045892    negative regulation of transcription, DNA-templated    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0045116    protein neddylation    Covalent attachment of the ubiquitin-like protein NEDD8 (RUB1) to another protein.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0051726    regulation of cell cycle    Any process that modulates the rate or extent of progression through the cell cycle.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain I,J   (NEDD8_HUMAN | Q15843)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
    GO:0009653    anatomical structure morphogenesis    The process in which anatomical structures are generated and organized. Morphogenesis pertains to the creation of form.
    GO:0006464    cellular protein modification process    The covalent alteration of one or more amino acids occurring in proteins, peptides and nascent polypeptides (co-translational, post-translational modifications) occurring at the level of an individual cell. Includes the modification of charged tRNAs that are destined to occur in a protein (pre-translation modification).
    GO:0008104    protein localization    Any process in which a protein is transported to, or maintained in, a specific location.
    GO:0045116    protein neddylation    Covalent attachment of the ubiquitin-like protein NEDD8 (RUB1) to another protein.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0006357    regulation of transcription from RNA polymerase II promoter    Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0014070    response to organic cyclic compound    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
    GO:0007179    transforming growth factor beta receptor signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    B39  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3gzn)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3gzn
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NEDD8_HUMAN | Q15843
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UBA3_HUMAN | Q8TBC4
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  ULA1_HUMAN | Q13564
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  6.3.2.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  NEDD8_HUMAN | Q15843
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  UBA3_HUMAN | Q8TBC4
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  ULA1_HUMAN | Q13564
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NEDD8_HUMAN | Q158431ndd 1r4m 1r4n 1xt9 2bkr 2ko3 2n7k 2nvu 3dbh 3dbl 3dbr 3dqv 4f8c 4fbj 4hcp 4p5o
        UBA3_HUMAN | Q8TBC41r4m 1r4n 1tt5 1y8x 1yov 2lq7 2nvu 3dbh 3dbl 3dbr 3fn1 5jjm
        ULA1_HUMAN | Q135641r4m 1r4n 1tt5 1yov 2nvu 3dbh 3dbl 3dbr

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3GZN)