Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  COMPLEX OF A LOW AFFINITY COLLAGEN SITE WITH THE FIBRONECTIN 8-9FNI DOMAIN PAIR
 
Authors :  B. Sladek, I. D. Campbell, I. Vakonakis
Date :  02 Apr 09  (Deposition) - 07 Apr 10  (Release) - 29 Jan 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym. Unit :  A,B,E,F
Biol. Unit 1:  B,F  (1x)
Biol. Unit 2:  A,E  (1x)
Keywords :  Protein-Peptide Complex, Cell Adhesion (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. C. Erat, B. Sladek, I. D. Campbell, I. Vakonakis
Structural Analysis Of Collagen Type I Interactions With Human Fibronectin Reveals A Cooperative Binding Mode
J. Biol. Chem. V. 288 17441 2013
PubMed-ID: 23653354  |  Reference-DOI: 10.1074/JBC.M113.469841

(-) Compounds

Molecule 1 - FIBRONECTIN
    ChainsB, A
    EngineeredYES
    Expression SystemPICHIA PASTORIS
    Expression System StrainX-33
    Expression System Taxid4922
    Expression System Vector TypeGENOMIC INTEGRATION
    Fragment8-9FNI, UNP RESIDUES 516-608
    GeneFN
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymFN, COLD-INSOLUBLE GLOBULIN, CIG, UGL-Y1, UGL-Y2, UGL-Y3
 
Molecule 2 - COLLAGEN ALPHA-1(I) CHAIN
    ChainsF
    EngineeredYES
    FragmentCOLI.260, UNP RESIDUES 254-275
    Other DetailsSTANDARD PEPTIDE SYNTHESIS
    SynonymALPHA-1 TYPE I COLLAGEN
    SyntheticYES
 
Molecule 3 - COLLAGEN ALPHA-1(I) CHAIN
    ChainsE
    EngineeredYES
    FragmentCOLI.260, UNP RESIDUES 254-275
    Other DetailsSTANDARD PEPTIDE SYNTHESIS
    SynonymALPHA-1 TYPE I COLLAGEN
    SyntheticYES

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABEF
Biological Unit 1 (1x) B F
Biological Unit 2 (1x)A E 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 5)

Asymmetric Unit (4, 5)
No.NameCountTypeFull Name
1GOL1Ligand/IonGLYCEROL
2HYP1Mod. Amino Acid4-HYDROXYPROLINE
3HZP1Mod. Amino Acid(4S)-4-HYDROXY-L-PROLINE
4NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 1 (2, 2)
No.NameCountTypeFull Name
1GOL-1Ligand/IonGLYCEROL
2HYP-1Mod. Amino Acid4-HYDROXYPROLINE
3HZP1Mod. Amino Acid(4S)-4-HYDROXY-L-PROLINE
4NAG1Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 2 (3, 3)
No.NameCountTypeFull Name
1GOL1Ligand/IonGLYCEROL
2HYP1Mod. Amino Acid4-HYDROXYPROLINE
3HZP-1Mod. Amino Acid(4S)-4-HYDROXY-L-PROLINE
4NAG1Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHOH A:610 , ASN B:542 , CYS B:543 , THR B:544 , LYS B:554 , ASP B:556 , HOH B:609 , LYS E:265BINDING SITE FOR RESIDUE NAG B 1
2AC2SOFTWAREASN A:542 , CYS A:543 , THR A:544 , LYS A:554 , ASP A:556 , HOH A:612 , LYS F:265BINDING SITE FOR RESIDUE NAG A 1
3AC3SOFTWAREPHE A:546 , HOH A:610BINDING SITE FOR RESIDUE GOL A 609

(-) SS Bonds  (8, 8)

Asymmetric Unit
No.Residues
1A:518 -A:545
2A:543 -A:555
3A:561 -A:589
4A:587 -A:599
5B:518 -B:545
6B:543 -B:555
7B:561 -B:589
8B:587 -B:599

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3GXE)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (4, 7)

Asymmetric Unit (4, 7)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_001646G263RCO1A1_HUMANDisease (OI1)  ---E/FG263R
2UniProtVAR_001647G263VCO1A1_HUMANDisease (OI1)  ---E/FG263V
3UniProtVAR_063298G266ECO1A1_HUMANDisease (OI1)  ---E/FG266E
4UniProtVAR_001648G272CCO1A1_HUMANDisease (OI1)  ---EG272C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (3, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_001646G263RCO1A1_HUMANDisease (OI1)  ---FG263R
2UniProtVAR_001647G263VCO1A1_HUMANDisease (OI1)  ---FG263V
3UniProtVAR_063298G266ECO1A1_HUMANDisease (OI1)  ---FG266E

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_001646G263RCO1A1_HUMANDisease (OI1)  ---EG263R
2UniProtVAR_001647G263VCO1A1_HUMANDisease (OI1)  ---EG263V
3UniProtVAR_063298G266ECO1A1_HUMANDisease (OI1)  ---EG266E
4UniProtVAR_001648G272CCO1A1_HUMANDisease (OI1)  ---EG272C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 8)

Asymmetric Unit (2, 8)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FN1_2PS51091 Fibronectin type-I domain profile.FINC_HUMAN50-90
95-138
139-182
184-228
229-273
306-345
468-511
516-558
 
559-602
 
2204-2248
2249-2291
2293-2333
  4-
-
-
-
-
-
-
A:516-558
B:516-558
A:559-602
B:559-602
-
-
-
2FN1_1PS01253 Fibronectin type-I domain signature.FINC_HUMAN52-87
97-135
141-179
186-225
231-270
308-342
470-508
518-555
 
561-599
 
2206-2245
2251-2288
2295-2330
  4-
-
-
-
-
-
-
A:518-555
B:518-555
A:561-599
B:561-599
-
-
-
Biological Unit 1 (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FN1_2PS51091 Fibronectin type-I domain profile.FINC_HUMAN50-90
95-138
139-182
184-228
229-273
306-345
468-511
516-558
 
559-602
 
2204-2248
2249-2291
2293-2333
  2-
-
-
-
-
-
-
-
B:516-558
-
B:559-602
-
-
-
2FN1_1PS01253 Fibronectin type-I domain signature.FINC_HUMAN52-87
97-135
141-179
186-225
231-270
308-342
470-508
518-555
 
561-599
 
2206-2245
2251-2288
2295-2330
  2-
-
-
-
-
-
-
-
B:518-555
-
B:561-599
-
-
-
Biological Unit 2 (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FN1_2PS51091 Fibronectin type-I domain profile.FINC_HUMAN50-90
95-138
139-182
184-228
229-273
306-345
468-511
516-558
 
559-602
 
2204-2248
2249-2291
2293-2333
  2-
-
-
-
-
-
-
A:516-558
-
A:559-602
-
-
-
-
2FN1_1PS01253 Fibronectin type-I domain signature.FINC_HUMAN52-87
97-135
141-179
186-225
231-270
308-342
470-508
518-555
 
561-599
 
2206-2245
2251-2288
2295-2330
  2-
-
-
-
-
-
-
A:518-555
-
A:561-599
-
-
-
-

(-) Exons   (5, 10)

Asymmetric Unit (5, 10)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002259641ENSE00002177604chr17:48278993-48278772222CO1A1_HUMAN1-35350--
1.2bENST000002259642bENSE00000736698chr17:48277308-48277114195CO1A1_HUMAN35-100660--
1.3aENST000002259643aENSE00000736703chr17:48276951-4827691735CO1A1_HUMAN100-111120--
1.3cENST000002259643cENSE00000819876chr17:48276814-4827677936CO1A1_HUMAN112-123120--
1.4cENST000002259644cENSE00000819877chr17:48276688-48276587102CO1A1_HUMAN124-157340--
1.5bENST000002259645bENSE00000736713chr17:48275865-4827579472CO1A1_HUMAN158-181240--
1.6ENST000002259646ENSE00001409307chr17:48275566-4827552245CO1A1_HUMAN182-196150--
1.7ENST000002259647ENSE00001415928chr17:48275363-4827531054CO1A1_HUMAN197-214180--
1.8ENST000002259648ENSE00001625237chr17:48275146-4827509354CO1A1_HUMAN215-232180--
1.9ENST000002259649ENSE00001425380chr17:48274594-4827454154CO1A1_HUMAN233-250180--
1.10ENST0000022596410ENSE00001423806chr17:48274424-4827437154CO1A1_HUMAN251-268182E:254-268 (gaps)
F:260-268
15
9
1.11ENST0000022596411ENSE00000736739chr17:48274031-4827397854CO1A1_HUMAN269-286182E:269-273
F:269-270
5
2
1.12cENST0000022596412cENSE00000736743chr17:48273889-4827384545CO1A1_HUMAN287-301150--
1.12dENST0000022596412dENSE00000736747chr17:48273728-4827367554CO1A1_HUMAN302-319180--
1.13aENST0000022596413aENSE00000736751chr17:48273560-4827351645CO1A1_HUMAN320-334150--
1.14ENST0000022596414ENSE00001765229chr17:48273337-4827328454CO1A1_HUMAN335-352180--
1.15ENST0000022596415ENSE00001241881chr17:48273026-4827292899CO1A1_HUMAN353-385330--
1.16ENST0000022596416ENSE00000736762chr17:48272839-4827279545CO1A1_HUMAN386-400150--
1.17ENST0000022596417ENSE00000736765chr17:48272691-4827259399CO1A1_HUMAN401-433330--
1.18ENST0000022596418ENSE00000736768chr17:48272461-4827240854CO1A1_HUMAN434-451180--
1.19ENST0000022596419ENSE00000736772chr17:48272189-48272082108CO1A1_HUMAN452-487360--
1.20ENST0000022596420ENSE00000736776chr17:48271987-4827193454CO1A1_HUMAN488-505180--
1.21aENST0000022596421aENSE00000736779chr17:48271808-4827171099CO1A1_HUMAN506-538330--
1.22aENST0000022596422aENSE00000736782chr17:48271544-4827149154CO1A1_HUMAN539-556180--
1.22dENST0000022596422dENSE00000736786chr17:48271402-4827130499CO1A1_HUMAN557-589330--
1.23ENST0000022596423ENSE00000736790chr17:48270408-4827035554CO1A1_HUMAN590-607180--
1.24ENST0000022596424ENSE00001739834chr17:48270211-4827015854CO1A1_HUMAN608-625180--
1.25ENST0000022596425ENSE00000736796chr17:48270054-4827000154CO1A1_HUMAN626-643180--
1.26ENST0000022596426ENSE00000736799chr17:48269889-4826983654CO1A1_HUMAN644-661180--
1.27bENST0000022596427bENSE00000736802chr17:48269385-4826934145CO1A1_HUMAN662-676150--
1.28bENST0000022596428bENSE00000736805chr17:48269247-4826914999CO1A1_HUMAN677-709330--
1.29ENST0000022596429ENSE00000736808chr17:48268851-48268744108CO1A1_HUMAN710-745360--
1.30bENST0000022596430bENSE00000736811chr17:48268285-48268178108CO1A1_HUMAN746-781360--
1.31aENST0000022596431aENSE00000736814chr17:48267957-4826790454CO1A1_HUMAN782-799180--
1.31cENST0000022596431cENSE00000736819chr17:48267741-4826768854CO1A1_HUMAN800-817180--
1.32ENST0000022596432ENSE00000736823chr17:48267469-48267362108CO1A1_HUMAN818-853360--
1.33ENST0000022596433ENSE00000736827chr17:48267273-4826722054CO1A1_HUMAN854-871180--
1.34ENST0000022596434ENSE00000736830chr17:48267093-4826704054CO1A1_HUMAN872-889180--
1.35ENST0000022596435ENSE00000736832chr17:48266899-48266738162CO1A1_HUMAN890-943540--
1.36ENST0000022596436ENSE00000736834chr17:48266636-48266529108CO1A1_HUMAN944-979360--
1.37ENST0000022596437ENSE00000736836chr17:48266371-48266264108CO1A1_HUMAN980-1015360--
1.38aENST0000022596438aENSE00000736838chr17:48266156-4826610354CO1A1_HUMAN1016-1033180--
1.39aENST0000022596439aENSE00000736840chr17:48265998-48265891108CO1A1_HUMAN1034-1069360--
1.39dENST0000022596439dENSE00000736842chr17:48265510-4826545754CO1A1_HUMAN1070-1087180--
1.39eENST0000022596439eENSE00001644681chr17:48265344-48265237108CO1A1_HUMAN1088-1123360--
1.40ENST0000022596440ENSE00000736847chr17:48264898-4826484554CO1A1_HUMAN1124-1141180--
1.41ENST0000022596441ENSE00001594859chr17:48264483-48264376108CO1A1_HUMAN1142-1177360--
1.42aENST0000022596442aENSE00000736851chr17:48264283-48264001283CO1A1_HUMAN1178-1272950--
1.43aENST0000022596443aENSE00000736853chr17:48263868-48263678191CO1A1_HUMAN1272-1335640--
1.43cENST0000022596443cENSE00000736855chr17:48263381-48263139243CO1A1_HUMAN1336-1416810--
1.44ENST0000022596444ENSE00001132088chr17:48263009-482606502360CO1A1_HUMAN1417-1464480--

2.1cENST000003596711cENSE00001245714chr2:216300791-216300378414FINC_HUMAN1-50500--
2.2ENST000003596712ENSE00001342487chr2:216299547-216299419129FINC_HUMAN50-93440--
2.3ENST000003596713ENSE00001146266chr2:216298184-216298047138FINC_HUMAN93-139470--
2.4ENST000003596714ENSE00001342465chr2:216296687-216296556132FINC_HUMAN139-183450--
2.5ENST000003596715ENSE00001342461chr2:216295575-216295438138FINC_HUMAN183-229470--
2.6ENST000003596716ENSE00001146236chr2:216293061-216292903159FINC_HUMAN229-282540--
2.7ENST000003596717ENSE00001245674chr2:216290008-216289817192FINC_HUMAN282-346650--
2.8ENST000003596718ENSE00001245669chr2:216289048-216288869180FINC_HUMAN346-406610--
2.9ENST000003596719ENSE00001146209chr2:216288249-216288073177FINC_HUMAN406-465600--
2.10ENST0000035967110ENSE00001245657chr2:216286966-216286814153FINC_HUMAN465-516522A:516-516
B:516-516
1
1
2.11bENST0000035967111bENSE00001342442chr2:216285524-216285396129FINC_HUMAN516-559442A:516-559
B:516-559
44
44
2.12bENST0000035967112bENSE00001146180chr2:216284108-216283965144FINC_HUMAN559-607492A:559-602
B:559-604
44
46
2.13aENST0000035967113aENSE00001223232chr2:216279681-216279560122FINC_HUMAN607-647410--
2.14aENST0000035967114aENSE00001342433chr2:216274837-216274657181FINC_HUMAN648-708610--
2.14cENST0000035967114cENSE00001342429chr2:216274462-216274286177FINC_HUMAN708-767600--
2.15bENST0000035967115bENSE00001146152chr2:216273149-216273021129FINC_HUMAN767-810440--
2.16ENST0000035967116ENSE00001342422chr2:216272920-21627283190FINC_HUMAN810-840310--
2.17ENST0000035967117ENSE00001342419chr2:216272044-216271850195FINC_HUMAN840-905660--
2.18ENST0000035967118ENSE00001342416chr2:216271233-216270961273FINC_HUMAN905-996920--
2.19ENST0000035967119ENSE00001146122chr2:216269378-216269112267FINC_HUMAN996-1085900--
2.20ENST0000035967120ENSE00001146112chr2:216264074-21626398095FINC_HUMAN1085-1116320--
2.21bENST0000035967121bENSE00000965892chr2:216262571-216262403169FINC_HUMAN1117-1173570--
2.22ENST0000035967122ENSE00001146105chr2:216261946-21626186087FINC_HUMAN1173-1202300--
2.23ENST0000035967123ENSE00001342408chr2:216259442-216259251192FINC_HUMAN1202-1266650--
2.25cENST0000035967125cENSE00001146412chr2:216256537-216256355183FINC_HUMAN1266-1327620--
2.26ENST0000035967126ENSE00001342403chr2:216253024-21625293590FINC_HUMAN1327-1357310--
2.27aENST0000035967127aENSE00001342401chr2:216251681-216251412270FINC_HUMAN1357-1447910--
2.28aENST0000035967128aENSE00001342398chr2:216249699-216249583117FINC_HUMAN1447-1486400--
2.28cENST0000035967128cENSE00001146062chr2:216248907-216248743165FINC_HUMAN1486-1541560--
2.29ENST0000035967129ENSE00001342394chr2:216248206-216248051156FINC_HUMAN1541-1593530--
2.30aENST0000035967130aENSE00001146049chr2:216247048-216246935114FINC_HUMAN1593-1631390--
2.30fENST0000035967130fENSE00001245789chr2:216245803-216245534270FINC_HUMAN1631-1721910--
2.30hENST0000035967130hENSE00001342389chr2:216244040-216243853188FINC_HUMAN1721-1783630--
2.31ENST0000035967131ENSE00001342388chr2:216242985-21624289888FINC_HUMAN1784-1813300--
2.32ENST0000035967132ENSE00001245772chr2:216241397-216241221177FINC_HUMAN1813-1872600--
2.33cENST0000035967133cENSE00001342219chr2:216240441-21624035290FINC_HUMAN1872-1902310--
2.34ENST0000035967134ENSE00001145995chr2:216240116-216239937180FINC_HUMAN1902-1962610--
2.35ENST0000035967135ENSE00001145987chr2:216238134-21623804590FINC_HUMAN1962-1992310--
2.36dENST0000035967136dENSE00001145978chr2:216237098-216236632467FINC_HUMAN1992-21471560--
2.37dENST0000035967137dENSE00001342210chr2:216235155-216235017139FINC_HUMAN2148-2194470--
2.38aENST0000035967138aENSE00001603320chr2:216232750-216232586165FINC_HUMAN2194-2249560--
2.39cENST0000035967139cENSE00001598844chr2:216230353-216230228126FINC_HUMAN2249-2291430--
2.40aENST0000035967140aENSE00001649647chr2:216229708-216229602107FINC_HUMAN2291-2326360--
2.41bENST0000035967141bENSE00001740966chr2:216226802-216226692111FINC_HUMAN2327-2363370--
2.42fENST0000035967142fENSE00001696465chr2:216226349-2162251811169FINC_HUMAN2364-2386230--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:87
 aligned with FINC_HUMAN | P02751 from UniProtKB/Swiss-Prot  Length:2386

    Alignment length:87
                                   525       535       545       555       565       575       585       595       
           FINC_HUMAN   516 DQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPL 602
               SCOP domains --------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..eeee...eeeee.....eeeeeeee....eeeeee..eee......eee...eeeeee..eeeeeeeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) FN1_2  PDB: A:516-558 UniProt: 516-558     FN1_2  PDB: A:559-602 UniProt: 559-602       PROSITE (1)
                PROSITE (2) --FN1_1  PDB: A:518-555 UniProt: 518-555-----FN1_1  PDB: A:561-599 UniProt: 561-599 --- PROSITE (2)
           Transcript 2 (1) 2------------------------------------------Exon 2.12b  PDB: A:559-602 UniProt: 559-607  Transcript 2 (1)
           Transcript 2 (2) Exon 2.11b  PDB: A:516-559 UniProt: 516-559 ------------------------------------------- Transcript 2 (2)
                 3gxe A 516 DQCIVDDITYNVQDTFHKKHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPL 602
                                   525       535       545       555       565       575       585       595       

Chain B from PDB  Type:PROTEIN  Length:89
 aligned with FINC_HUMAN | P02751 from UniProtKB/Swiss-Prot  Length:2386

    Alignment length:89
                                   525       535       545       555       565       575       585       595         
           FINC_HUMAN   516 DQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQT 604
               SCOP domains ----------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..eeee..eeeeee.....eeeeeeee....eeeeee..eee......eee...eeeeee..eeeeeeeee....eeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) FN1_2  PDB: B:516-558 UniProt: 516-558     FN1_2  PDB: B:559-602 UniProt: 559-602      -- PROSITE (1)
                PROSITE (2) --FN1_1  PDB: B:518-555 UniProt: 518-555-----FN1_1  PDB: B:561-599 UniProt: 561-599 ----- PROSITE (2)
           Transcript 2 (1) 2------------------------------------------Exon 2.12b  PDB: B:559-604 UniProt: 559-607    Transcript 2 (1)
           Transcript 2 (2) Exon 2.11b  PDB: B:516-559 UniProt: 516-559 --------------------------------------------- Transcript 2 (2)
                 3gxe B 516 DQCIVDDITYNVQDTFHKKHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQT 604
                                   525       535       545       555       565       575       585       595         

Chain E from PDB  Type:PROTEIN  Length:16
 aligned with CO1A1_HUMAN | P02452 from UniProtKB/Swiss-Prot  Length:1464

    Alignment length:20
                                   263       273
          CO1A1_HUMAN   254 GLPGTAGLPGMKGHRGFSGL 273
               SCOP domains -------------------- SCOP domains
               CATH domains -------------------- CATH domains
               Pfam domains -------------------- Pfam domains
         Sec.struct. author ..----...eeee....... Sec.struct. author
             SAPs(SNPs) (1) ---------R--E-----C- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------V---------- SAPs(SNPs) (2)
                    PROSITE -------------------- PROSITE
               Transcript 1 Exon 1.10      1.11  Transcript 1
                 3gxe E 254 GL----GLpGMKGHRGFSGL 273
                             |    |263       273
                             |  260 |           
                           255    262-HYP       

Chain F from PDB  Type:PROTEIN  Length:11
 aligned with CO1A1_HUMAN | P02452 from UniProtKB/Swiss-Prot  Length:1464

    Alignment length:11
                                   269 
          CO1A1_HUMAN   260 GLPGMKGHRGF 270
               SCOP domains ----------- SCOP domains
               CATH domains ----------- CATH domains
               Pfam domains ----------- Pfam domains
         Sec.struct. author ....eee.... Sec.struct. author
             SAPs(SNPs) (1) ---R--E---- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---V------- SAPs(SNPs) (2)
                    PROSITE ----------- PROSITE
               Transcript 1 Exon 1.101. Transcript 1
                 3gxe F 260 GLpGMKGHRGF 270
                              |    269 
                            262-HZP    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3GXE)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3GXE)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3GXE)

(-) Gene Ontology  (123, 134)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (FINC_HUMAN | P02751)
molecular function
    GO:0005518    collagen binding    Interacting selectively and non-covalently with collagen, a group of fibrous proteins of very high tensile strength that form the main component of connective tissue in animals. Collagen is highly enriched in glycine (some regions are 33% glycine) and proline, occurring predominantly as 3-hydroxyproline (about 20%).
    GO:0008201    heparin binding    Interacting selectively and non-covalently with heparin, any member of a group of glycosaminoglycans found mainly as an intracellular component of mast cells and which consist predominantly of alternating alpha-(1->4)-linked D-galactose and N-acetyl-D-glucosamine-6-sulfate residues.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005178    integrin binding    Interacting selectively and non-covalently with an integrin.
    GO:0045340    mercury ion binding    Interacting selectively and non-covalently with mercury (Hg) ions.
    GO:0016504    peptidase activator activity    Binds to and increases the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
    GO:0002020    protease binding    Interacting selectively and non-covalently with any protease or peptidase.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006953    acute-phase response    An acute inflammatory response that involves non-antibody proteins whose concentrations in the plasma increase in response to infection or injury of homeothermic animals.
    GO:0001525    angiogenesis    Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
    GO:0007161    calcium-independent cell-matrix adhesion    The binding of a cell to the extracellular matrix via adhesion molecules that do not require the presence of calcium for the interaction.
    GO:0001775    cell activation    A change in the morphology or behavior of a cell resulting from exposure to an activating factor such as a cellular or soluble ligand.
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
    GO:0007160    cell-matrix adhesion    The binding of a cell to the extracellular matrix via adhesion molecules.
    GO:0007044    cell-substrate junction assembly    The aggregation, arrangement and bonding together of a set of components to form a junction between a cell and its substrate.
    GO:0071773    cellular response to BMP stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a bone morphogenetic protein (BMP) stimulus.
    GO:0071333    cellular response to glucose stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucose stimulus.
    GO:0071347    cellular response to interleukin-1    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-1 stimulus.
    GO:0071222    cellular response to lipopolysaccharide    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
    GO:0071288    cellular response to mercury ion    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mercury ion stimulus.
    GO:0036120    cellular response to platelet-derived growth factor stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a platelet-derived growth factor stimulus.
    GO:0071380    cellular response to prostaglandin E stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a prostagladin E stimulus.
    GO:0071560    cellular response to transforming growth factor beta stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a transforming growth factor beta stimulus.
    GO:0035924    cellular response to vascular endothelial growth factor stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a vascular endothelial growth factor stimulus.
    GO:0035987    endodermal cell differentiation    The process in which a relatively unspecialized cell acquires the specialized features of an endoderm cell, a cell of the inner of the three germ layers of the embryo.
    GO:0022617    extracellular matrix disassembly    A process that results in the breakdown of the extracellular matrix.
    GO:0030198    extracellular matrix organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
    GO:0008347    glial cell migration    The orderly movement of a glial cell, non-neuronal cells that provide support and nutrition, maintain homeostasis, form myelin, and participate in signal transmission in the nervous system.
    GO:0033622    integrin activation    The aggregation, arrangement and bonding together of an integrin, a heterodimeric adhesion receptor formed by the non-covalent association of particular alpha and beta subunits, that lead to the increased affinity of the integrin for its extracellular ligands.
    GO:0050900    leukocyte migration    The movement of a leukocyte within or between different tissues and organs of the body.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:2001202    negative regulation of transforming growth factor-beta secretion    Any process that stops, prevents or reduces the frequency, rate or extent of transforming growth factor-beta secretion.
    GO:0018149    peptide cross-linking    The formation of a covalent cross-link between or within protein chains.
    GO:0002576    platelet degranulation    The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
    GO:0045773    positive regulation of axon extension    Any process that activates or increases the frequency, rate or extent of axon extension.
    GO:0030335    positive regulation of cell migration    Any process that activates or increases the frequency, rate or extent of cell migration.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0050921    positive regulation of chemotaxis    Any process that activates or increases the frequency, rate or extent of the directed movement of a motile cell or organism in response to a specific chemical concentration gradient.
    GO:0048146    positive regulation of fibroblast proliferation    Any process that activates or increases the frequency, rate or extent of multiplication or reproduction of fibroblast cells.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0010952    positive regulation of peptidase activity    Any process that increases the frequency, rate or extent of peptidase activity, the hydrolysis of peptide bonds within proteins.
    GO:1904237    positive regulation of substrate-dependent cell migration, cell attachment to substrate    Any process that activates or increases the frequency, rate or extent of substrate-dependent cell migration, cell attachment to substrate.
    GO:0070372    regulation of ERK1 and ERK2 cascade    Any process that modulates the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0008360    regulation of cell shape    Any process that modulates the surface configuration of a cell.
    GO:0001932    regulation of protein phosphorylation    Any process that modulates the frequency, rate or extent of addition of phosphate groups into an amino acid in a protein.
    GO:0051384    response to glucocorticoid    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucocorticoid stimulus. Glucocorticoids are hormonal C21 corticosteroids synthesized from cholesterol with the ability to bind with the cortisol receptor and trigger similar effects. Glucocorticoids act primarily on carbohydrate and protein metabolism, and have anti-inflammatory effects.
    GO:0002931    response to ischemia    Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a inadequate blood supply.
    GO:0010193    response to ozone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a ozone stimulus.
    GO:0009611    response to wounding    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to the organism.
    GO:0034446    substrate adhesion-dependent cell spreading    The morphogenetic process that results in flattening of a cell as a consequence of its adhesion to a substrate.
    GO:0042060    wound healing    The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
    GO:0016324    apical plasma membrane    The region of the plasma membrane located at the apical end of the cell.
    GO:0005605    basal lamina    A thin sheet of proteoglycans and glycoproteins, especially laminin, secreted by cells as an extracellular matrix.
    GO:0005604    basement membrane    A thin layer of dense material found in various animal tissues interposed between the cells and the adjacent connective tissue. It consists of the basal lamina plus an associated layer of reticulin fibers.
    GO:0072562    blood microparticle    A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
    GO:0005793    endoplasmic reticulum-Golgi intermediate compartment    A complex system of membrane-bounded compartments located between endoplasmic reticulum (ER) and the Golgi complex, with a distinctive membrane protein composition; involved in ER-to-Golgi and Golgi-to-ER transport.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0031012    extracellular matrix    A structure lying external to one or more cells, which provides structural support for cells or tissues.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0005577    fibrinogen complex    A highly soluble, elongated protein complex found in blood plasma and involved in clot formation. It is converted into fibrin monomer by the action of thrombin. In the mouse, fibrinogen is a hexamer, 46 nm long and 9 nm maximal diameter, containing two sets of nonidentical chains (alpha, beta, and gamma) linked together by disulfide bonds.
    GO:0031093    platelet alpha granule lumen    The volume enclosed by the membrane of the platelet alpha granule.
    GO:0005578    proteinaceous extracellular matrix    A layer consisting mainly of proteins (especially collagen) and glycosaminoglycans (mostly as proteoglycans) that forms a sheet underlying or overlying cells such as endothelial and epithelial cells. The proteins are secreted by cells in the vicinity. An example of this component is found in Mus musculus.

Chain E,F   (CO1A1_HUMAN | P02452)
molecular function
    GO:0005201    extracellular matrix structural constituent    The action of a molecule that contributes to the structural integrity of the extracellular matrix.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0048407    platelet-derived growth factor binding    Interacting selectively and non-covalently with platelet-derived growth factor.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0001568    blood vessel development    The process whose specific outcome is the progression of a blood vessel over time, from its formation to the mature structure. The blood vessel is the vasculature carrying blood.
    GO:0060346    bone trabecula formation    The process of creating a trabecula in the bone. A trabecula is a tissue element in the form of a small beam, strut or rod.
    GO:0060351    cartilage development involved in endochondral bone morphogenesis    The process whose specific outcome is the progression of the cartilage that will provide a scaffold for mineralization of endochondral bones.
    GO:0071230    cellular response to amino acid stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amino acid stimulus. An amino acid is a carboxylic acids containing one or more amino groups.
    GO:0071364    cellular response to epidermal growth factor stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an epidermal growth factor stimulus.
    GO:0044344    cellular response to fibroblast growth factor stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an fibroblast growth factor stimulus.
    GO:1902618    cellular response to fluoride    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a fluoride stimulus.
    GO:0071260    cellular response to mechanical stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mechanical stimulus.
    GO:0071300    cellular response to retinoic acid    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a retinoic acid stimulus.
    GO:0071560    cellular response to transforming growth factor beta stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a transforming growth factor beta stimulus.
    GO:0071356    cellular response to tumor necrosis factor    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a tumor necrosis factor stimulus.
    GO:0071306    cellular response to vitamin E    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a vitamin E stimulus.
    GO:0032964    collagen biosynthetic process    The chemical reactions and pathways resulting in the formation of collagen, any of a group of fibrous proteins of very high tensile strength that form the main component of connective tissue in animals. Collagen is highly enriched in glycine (some regions are 33% glycine) and proline, occurring predominantly as 3-hydroxyproline (about 20%).
    GO:0030574    collagen catabolic process    The proteolytic chemical reactions and pathways resulting in the breakdown of collagen in the extracellular matrix, usually carried out by proteases secreted by nearby cells.
    GO:0030199    collagen fibril organization    Any process that determines the size and arrangement of collagen fibrils within an extracellular matrix.
    GO:0048706    embryonic skeletal system development    The process, occurring during the embryonic phase, whose specific outcome is the progression of the skeleton over time, from its formation to the mature structure.
    GO:0001958    endochondral ossification    Replacement ossification wherein bone tissue replaces cartilage.
    GO:0030198    extracellular matrix organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
    GO:0060325    face morphogenesis    The process in which the anatomical structures of the face are generated and organized. The face is the ventral division of the head.
    GO:0001957    intramembranous ossification    Direct ossification that occurs within mesenchyme or an accumulation of relatively unspecialized cells.
    GO:0050900    leukocyte migration    The movement of a leukocyte within or between different tissues and organs of the body.
    GO:0010812    negative regulation of cell-substrate adhesion    Any process that decreases the frequency, rate or extent of cell-substrate adhesion. Cell-substrate adhesion is the attachment of a cell to the underlying substrate via adhesion molecules.
    GO:0001503    ossification    The formation of bone or of a bony substance, or the conversion of fibrous tissue or of cartilage into bone or a bony substance.
    GO:0001649    osteoblast differentiation    The process whereby a relatively unspecialized cell acquires the specialized features of an osteoblast, a mesodermal or neural crest cell that gives rise to bone.
    GO:0030168    platelet activation    A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
    GO:0090263    positive regulation of canonical Wnt signaling pathway    Any process that increases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
    GO:0030335    positive regulation of cell migration    Any process that activates or increases the frequency, rate or extent of cell migration.
    GO:0010718    positive regulation of epithelial to mesenchymal transition    Any process that increases the rate, frequency, or extent of epithelial to mesenchymal transition. Epithelial to mesenchymal transition is where an epithelial cell loses apical/basolateral polarity, severs intercellular adhesive junctions, degrades basement membrane components and becomes a migratory mesenchymal cell.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0070208    protein heterotrimerization    The formation of a protein heterotrimer, a macromolecular structure consisting of three noncovalently associated subunits, of which not all are identical.
    GO:0034504    protein localization to nucleus    A process in which a protein transports or maintains the localization of another protein to the nucleus.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0050776    regulation of immune response    Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
    GO:0051591    response to cAMP    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
    GO:0031960    response to corticosteroid    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a corticosteroid hormone stimulus. A corticosteroid is a steroid hormone that is produced in the adrenal cortex. Corticosteroids are involved in a wide range of physiologic systems such as stress response, immune response and regulation of inflammation, carbohydrate metabolism, protein catabolism, blood electrolyte levels, and behavior. They include glucocorticoids and mineralocorticoids.
    GO:0042493    response to drug    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0032355    response to estradiol    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by estradiol, a C18 steroid hormone hydroxylated at C3 and C17 that acts as a potent estrogen.
    GO:1902617    response to fluoride    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a fluoride stimulus.
    GO:0042542    response to hydrogen peroxide    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hydrogen peroxide (H2O2) stimulus.
    GO:0055093    response to hyperoxia    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating increased oxygen tension.
    GO:0009612    response to mechanical stimulus    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mechanical stimulus.
    GO:0007584    response to nutrient    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nutrient stimulus.
    GO:0031667    response to nutrient levels    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus reflecting the presence, absence, or concentration of nutrients.
    GO:0043434    response to peptide hormone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a peptide hormone stimulus. A peptide hormone is any of a class of peptides that are secreted into the blood stream and have endocrine functions in living animals.
    GO:0048545    response to steroid hormone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a steroid hormone stimulus.
    GO:0007605    sensory perception of sound    The series of events required for an organism to receive an auditory stimulus, convert it to a molecular signal, and recognize and characterize the signal. Sonic stimuli are detected in the form of vibrations and are processed to form a sound.
    GO:0001501    skeletal system development    The process whose specific outcome is the progression of the skeleton over time, from its formation to the mature structure. The skeleton is the bony framework of the body in vertebrates (endoskeleton) or the hard outer envelope of insects (exoskeleton or dermoskeleton).
    GO:0048705    skeletal system morphogenesis    The process in which the anatomical structures of the skeleton are generated and organized.
    GO:0043588    skin development    The process whose specific outcome is the progression of the skin over time, from its formation to the mature structure. The skin is the external membranous integument of an animal. In vertebrates the skin generally consists of two layers, an outer nonsensitive and nonvascular epidermis (cuticle or skarfskin) composed of cells which are constantly growing and multiplying in the deeper, and being thrown off in the superficial layers, as well as an inner vascular dermis (cutis, corium or true skin) composed mostly of connective tissue.
    GO:0043589    skin morphogenesis    The process in which the anatomical structures of the skin are generated and organized. The skin is the external membranous integument of an animal. In vertebrates the skin generally consists of two layers, an outer nonsensitive and nonvascular epidermis (cuticle or skarfskin) composed of cells which are constantly growing and multiplying in the deeper, and being thrown off in the superficial layers, as well as an inner, sensitive and vascular dermis (cutis, corium or true skin) composed mostly of connective tissue.
    GO:0044691    tooth eruption    The tooth development process in which the teeth enter the mouth and become visible.
    GO:0034505    tooth mineralization    The process in which calcium salts are deposited into calcareous tooth structures such as dental enamel, dentin and cementum.
    GO:0007601    visual perception    The series of events required for an organism to receive a visual stimulus, convert it to a molecular signal, and recognize and characterize the signal. Visual stimuli are detected in the form of photons and are processed to form an image.
    GO:0042060    wound healing    The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0005581    collagen trimer    A protein complex consisting of three collagen chains assembled into a left-handed triple helix. These trimers typically assemble into higher order structures.
    GO:0005584    collagen type I trimer    A collagen trimer containing alpha(I) chains. The most common form of type I collagen is a heterotrimer containing two alpha1(I) chains and one alpha2(I) chain; homotrimers containing three alpha1(I) chains are also found. Type I collagen triple helices associate to form banded fibrils.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0005788    endoplasmic reticulum lumen    The volume enclosed by the membranes of the endoplasmic reticulum.
    GO:0031012    extracellular matrix    A structure lying external to one or more cells, which provides structural support for cells or tissues.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0005578    proteinaceous extracellular matrix    A layer consisting mainly of proteins (especially collagen) and glycosaminoglycans (mostly as proteoglycans) that forms a sheet underlying or overlying cells such as endothelial and epithelial cells. The proteins are secreted by cells in the vicinity. An example of this component is found in Mus musculus.
    GO:0030141    secretory granule    A small subcellular vesicle, surrounded by a membrane, that is formed from the Golgi apparatus and contains a highly concentrated protein destined for secretion. Secretory granules move towards the periphery of the cell and upon stimulation, their membranes fuse with the cell membrane, and their protein load is exteriorized. Processing of the contained protein may take place in secretory granules.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HYP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HZP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3gxe)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3gxe
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CO1A1_HUMAN | P02452
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  FINC_HUMAN | P02751
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  166200
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CO1A1_HUMAN | P02452
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FINC_HUMAN | P02751
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CO1A1_HUMAN | P024521q7d 2llp 3ejh 5ctd 5cti 5cva 5cvb 5k31
        FINC_HUMAN | P027511e88 1e8b 1fbr 1fna 1fnf 1fnh 1j8k 1o9a 1oww 1q38 1qgb 1qo6 1ttf 1ttg 2cg6 2cg7 2ck2 2cku 2ec3 2fn2 2fnb 2gee 2h41 2h45 2ha1 2mnu 2n1k 2ocf 2rky 2rkz 2rl0 3cal 3ejh 3m7p 3mql 3r8q 3t1w 3zrz 4gh7 4je4 4jeg 4lxo 4mmx 4mmy 4mmz 4pz5 5dc0 5dc4 5dc9 5dft 5j6z 5j7c

(-) Related Entries Specified in the PDB File

3ejh STRUCTURE OF A HIGH AFFINITY COMPLEX BETWEEN 8-9FNI AND COLLAGEN