Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN DBP5 IN COMPLEX WITH NUP214
 
Authors :  H. Von Moeller, E. Conti
Date :  09 Dec 08  (Deposition) - 17 Feb 09  (Release) - 05 Feb 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Dead-Box Helicase, Mrna Export, Nucleoporin, Beta Propeller, Reca- Like, Rna Dependent Atpase, Can, Ddx19, Dead-Box Protein 19B, Nuclear Pore Complex, Glycoprotein, Mrna Transport, Nucleus, Phosphoprotein, Protein Transport, Proto-Oncogene, Translocation, Transport, Atp-Binding, Helicase, Hydrolase, Membrane, Nucleotide- Binding, Rna-Binding, Transport Protein-Hydrolase Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Von Moeller, C. Basquin, E. Conti
The Mrna Export Protein Dbp5 Binds Rna And The Cytoplasmic Nucleoporin Nup214 In A Mutually Exclusive Manner
Nat. Struct. Mol. Biol. V. 16 247 2009
PubMed-ID: 19219046  |  Reference-DOI: 10.1038/NSMB.1561

(-) Compounds

Molecule 1 - NUCLEAR PORE COMPLEX PROTEIN NUP214
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPETMC
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    FragmentNTERMINAL BETA PROPELLER, UNP RESIDUES 1-405
    GeneNUP214 (RESIDUES 1-405)
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymNUCLEOPORIN 214KDA, NUP214, NUCLEOPORIN NUP214, 214 KDA NUCLEOPORIN, PROTEIN CAN
 
Molecule 2 - ATP-DEPENDENT RNA HELICASE DDX19B
    ChainsB
    EC Number3.6.1.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPETMC
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    FragmentNTERMINAL RECA-LIKE DOMAIN, UNP RESIDUES 68-302
    GeneDBP5 (RESIDUES 68-302)
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymDEAD-BOX HELICASE 5, DBP5, DEAD BOX PROTEIN 19B, DEAD BOX RNA HELICASE DEAD5

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3FHC)

(-) Sites  (0, 0)

(no "Site" information available for 3FHC)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3FHC)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Glu A:281 -Lys A:282
2Glu B:129 -Pro B:130

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 1)

Asymmetric/Biological Unit (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052160V149LDD19B_HUMANPolymorphism34607244BV149L

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1Q_MOTIFPS51195 DEAD-box RNA helicase Q motif profile.DD19B_HUMAN92-120  1B:92-120

(-) Exons   (11, 11)

Asymmetric/Biological Unit (11, 11)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003594281aENSE00002184968chr9:134000948-134001136189NU214_HUMAN1-15151A:9-157
1.4ENST000003594284ENSE00000868176chr9:134002911-134003106196NU214_HUMAN16-81661A:16-8166
1.5ENST000003594285ENSE00000868177chr9:134003719-134003870152NU214_HUMAN81-131511A:81-13151
1.7bENST000003594287bENSE00000868178chr9:134004666-134004864199NU214_HUMAN132-198671A:132-198 (gaps)67
1.8ENST000003594288ENSE00000868179chr9:134006153-13400622371NU214_HUMAN198-221241A:198-22124
1.9aENST000003594289aENSE00000868180chr9:134007983-13400804664NU214_HUMAN222-243221A:222-24322
1.10aENST0000035942810aENSE00000868181chr9:134008493-134008596104NU214_HUMAN243-277351A:243-27735
1.11aENST0000035942811aENSE00000868182chr9:134010285-134010391107NU214_HUMAN278-313361A:278-31336
1.12aENST0000035942812aENSE00000868183chr9:134011327-13401139367NU214_HUMAN313-335231A:313-33523
1.13bENST0000035942813bENSE00000868184chr9:134014668-134014794127NU214_HUMAN336-378431A:336-37136
1.14ENST0000035942814ENSE00000868185chr9:134015936-134016097162NU214_HUMAN378-432551A:386-40520
1.15aENST0000035942815aENSE00000868186chr9:134019667-134020141475NU214_HUMAN432-5901590--
1.16bENST0000035942816bENSE00000868187chr9:134021516-134021691176NU214_HUMAN590-649600--
1.17bENST0000035942817bENSE00000868188chr9:134022877-13402297195NU214_HUMAN649-680320--
1.19ENST0000035942819ENSE00000868189chr9:134025711-13402579787NU214_HUMAN681-709290--
1.20ENST0000035942820ENSE00000868190chr9:134026003-134026152150NU214_HUMAN710-759500--
1.21bENST0000035942821bENSE00000868191chr9:134027123-134027281159NU214_HUMAN760-812530--
1.22ENST0000035942822ENSE00000868192chr9:134034770-134034873104NU214_HUMAN813-847350--
1.23aENST0000035942823aENSE00000868193chr9:134038378-134038560183NU214_HUMAN847-908620--
1.24ENST0000035942824ENSE00000868194chr9:134039257-13403934286NU214_HUMAN908-937300--
1.25aENST0000035942825aENSE00000868195chr9:134039448-13403953184NU214_HUMAN937-965290--
1.26aENST0000035942826aENSE00000868196chr9:134049442-134049705264NU214_HUMAN965-1053890--
1.27ENST0000035942827ENSE00000868197chr9:134050847-134051008162NU214_HUMAN1053-1107550--
1.29ENST0000035942829ENSE00001262699chr9:134053698-134053797100NU214_HUMAN1107-1140340--
1.30bENST0000035942830bENSE00000868199chr9:134062676-13406275176NU214_HUMAN1140-1165260--
1.31ENST0000035942831ENSE00000868200chr9:134064440-13406451879NU214_HUMAN1166-1192270--
1.33bENST0000035942833bENSE00000868201chr9:134067595-13406767985NU214_HUMAN1192-1220290--
1.34aENST0000035942834aENSE00000868202chr9:134070620-13407068162NU214_HUMAN1220-1241220--
1.35gENST0000035942835gENSE00000868203chr9:134072603-1340744021800NU214_HUMAN1241-18416010--
1.36ENST0000035942836ENSE00000868204chr9:134077034-13407710471NU214_HUMAN1841-1864240--
1.37ENST0000035942837ENSE00000868205chr9:134090599-134090755157NU214_HUMAN1865-1917530--
1.38bENST0000035942838bENSE00000868206chr9:134098165-134098317153NU214_HUMAN1917-1968520--
1.39bENST0000035942839bENSE00000868207chr9:134103547-134103718172NU214_HUMAN1968-2025580--
1.40cENST0000035942840cENSE00001764120chr9:134106017-134106156140NU214_HUMAN2025-2072480--
1.41aENST0000035942841aENSE00001793037chr9:134107671-13410769525NU214_HUMAN2072-208090--
1.42fENST0000035942842fENSE00001725375chr9:134108841-1341100571217NU214_HUMAN2080-2090110--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:381
 aligned with NU214_HUMAN | P35658 from UniProtKB/Swiss-Prot  Length:2090

    Alignment length:397
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       
          NU214_HUMAN     9 IPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSEYGSIIAFFDVRTFSNEAKQQKRPFAYHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVTETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQYLPTLQEKKVIPCPPFYESDHPVRVLDVLWIGTYVFAIVYAAADGTLETSPDVVMALLPKKEEKHPEIFVNFMEPCYGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDSLPMGVVVDYTNQVEITISDEKTLPPAPVLMLLSTDGVLCPFYMIN 405
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee....eeee..eee...............eeee....eeeee....eeeeehhhhh...........ee.....eee.....eeeeee.....eeeeeeee...eeeeeeee.hhhhh..--.....eeeeee.hhhh.eeeeee......eeeeee....eeeeee...eeeeeeehhhh.eeeeee......eeeee....eeee.....eeeee...........eeeeeeeeee..eeeeeeee.........eeeeee..........eeee...............eeeeee....eeeeee.....eeeeee......eeeee.hhhhh.............eeeeeee...--------------..eeeeee...eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.1a   Exon 1.4  PDB: A:16-81 UniProt: 16-81                             --------------------------------------------------Exon 1.7b  PDB: A:132-198 (gaps) UniProt: 132-198                  --------------------------------------------Exon 1.10a  PDB: A:243-277         Exon 1.11a  PDB: A:278-313          ----------------------Exon 1.13b  PDB: A:336-371 UniProt: 336-378--------------------------- Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------Exon 1.5  PDB: A:81-131 UniProt: 81-131            ------------------------------------------------------------------Exon 1.8  PDB: A:198-221Exon 1.9a             ---------------------------------------------------------------------Exon 1.12a             ------------------------------------------Exon 1.14  PDB: A:386-405    Transcript 1 (2)
                 3fhc A   9 IPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSEYGSIIAFFDVRTFSNEA--QKRPFAYHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVTETVKVCATLPSTVAVTSVCWSPKGKQLAVGKQNGTVVQYLPTLQEKKVIPCPPFYESDHPVRVLDVLWIGTYVFAIVYAAADGTLETSPDVVMALLPKKEEKHPEIFVNFMEPCYGSCTERQHHYYLSYIEEWDLVLAASAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDSLPMGVVVDYTN--------------APVLMLLSTDGVLCPFYMIN 405
                                    18        28        38        48        58        68        78        88        98       108       118       128   |  |138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368  |      -       388       398       
                                                                                                                                                     132  |                                                                                                                                                                                                                                         371            386                   
                                                                                                                                                        135                                                                                                                                                                                                                                                                              

Chain B from PDB  Type:PROTEIN  Length:224
 aligned with DD19B_HUMAN | Q9UMR2 from UniProtKB/Swiss-Prot  Length:479

    Alignment length:224
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294    
          DD19B_HUMAN    75 NQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLK 298
               SCOP domains d3fhcb_ B: automated matches                                                                                                                                                                                                     SCOP domains
               CATH domains 3fhcB00 B:75-298 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                            CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...........hhhhhh.hhhhhhhhhhh.....hhhhhhhhhhhhh.....eeee...hhhhhhhhhhhhhhhh........eeee..hhhhhhhhhhhhhhhh.......eeee...............eeeehhhhhhhhhhh....hhhhh.eeee.hhhhhh...hhhhhhhhhhhhh....eeeeee...hhhhhhhhhhhh...eeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------L----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------Q_MOTIF  PDB: B:92-120       ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3fhc B  75 NQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLK 298
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3FHC)

(-) Gene Ontology  (40, 47)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (NU214_HUMAN | P35658)
molecular function
    GO:0005049    nuclear export signal receptor activity    Combining with a nuclear export signal (NES) to mediate transport of the NES-containing protein through the nuclear pore to the cytoplasm.
    GO:0005487    nucleocytoplasmic transporter activity    Enables the directed movement of substances between the nucleus and the cytoplasm of a cell.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0005215    transporter activity    Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
    GO:0031047    gene silencing by RNA    Any process in which RNA molecules inactivate expression of target genes.
    GO:0075733    intracellular transport of virus    The directed movement of a virus, or part of a virus, within the host cell.
    GO:0006406    mRNA export from nucleus    The directed movement of mRNA from the nucleus to the cytoplasm.
    GO:0051028    mRNA transport    The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0007077    mitotic nuclear envelope disassembly    The cell cycle process in which the controlled breakdown of the nuclear envelope during mitotic cell division occurs.
    GO:0006611    protein export from nucleus    The directed movement of a protein from the nucleus into the cytoplasm.
    GO:0006606    protein import into nucleus    The directed movement of a protein from the cytoplasm to the nucleus.
    GO:0016925    protein sumoylation    The process in which a SUMO protein (small ubiquitin-related modifier) is conjugated to a target protein via an isopeptide bond between the carboxyl terminus of SUMO with an epsilon-amino group of a lysine residue of the target protein.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0051726    regulation of cell cycle    Any process that modulates the rate or extent of progression through the cell cycle.
    GO:1900034    regulation of cellular response to heat    Any process that modulates the frequency, rate or extent of cellular response to heat.
    GO:0010827    regulation of glucose transport    Any process that modulates the frequency, rate or extent of glucose transport. Glucose transport is the directed movement of the hexose monosaccharide glucose into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0043488    regulation of mRNA stability    Any process that modulates the propensity of mRNA molecules to degradation. Includes processes that both stabilize and destabilize mRNAs.
    GO:0006409    tRNA export from nucleus    The directed movement of tRNA from the nucleus to the cytoplasm.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
    GO:0019083    viral transcription    The process by which a viral genome, or part of a viral genome, is transcribed within the host cell.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0005643    nuclear pore    Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B   (DD19B_HUMAN | Q9UMR2)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0004004    ATP-dependent RNA helicase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate; this reaction drives the unwinding of an RNA helix.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0004386    helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0010501    RNA secondary structure unwinding    The process in which a secondary structure of RNA are broken or 'melted'.
    GO:0006406    mRNA export from nucleus    The directed movement of mRNA from the nucleus to the cytoplasm.
    GO:0051028    mRNA transport    The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005635    nuclear envelope    The double lipid bilayer enclosing the nucleus and separating its contents from the rest of the cytoplasm; includes the intermembrane space, a gap of width 20-40 nm (also called the perinuclear space).
    GO:0031965    nuclear membrane    Either of the lipid bilayers that surround the nucleus and form the nuclear envelope; excludes the intermembrane space.
    GO:0005643    nuclear pore    Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3fhc)
 
  Sites
(no "Sites" information available for 3fhc)
 
  Cis Peptide Bonds
    Glu A:281 - Lys A:282   [ RasMol ]  
    Glu B:129 - Pro B:130   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3fhc
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DD19B_HUMAN | Q9UMR2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  NU214_HUMAN | P35658
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.6.1.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  DD19B_HUMAN | Q9UMR2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  NU214_HUMAN | P35658
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DD19B_HUMAN | Q9UMR23ews 3fht 3fmo 3fmp 3g0h
        NU214_HUMAN | P356582oit 3fmo 3fmp 5dis

(-) Related Entries Specified in the PDB File

2oit CRYSTAL STRUCTURE OF THE N-TERMINAL DOMAIN OF THE HUMAN PROTO-ONCOGENE NUP214/CAN
3fht CRYSTAL STRUCTURE OF HUMAN DBP5 IN COMPLEX WITH AMPPNP AND RNA