Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF THE SIGNATURE DOMAIN OF CARTILAGE OLIGOMERIC MATRIX PROTEIN.
 
Authors :  K. Tan, J. Lawler
Date :  20 Nov 08  (Deposition) - 23 Jun 09  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.15
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Keywords :  Comp, Cartilage Oligomeric Matrix Protein, Signature Domain, E4T3C5, Cell Adhesion, Disease Mutation, Dwarfism, Egf-Like Domain, Glycoprotein, Secreted (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Tan, M. Duquette, A. Joachimiak, J. Lawler
The Crystal Structure Of The Signature Domain Of Cartilage Oligomeric Matrix Protein: Implications For Collagen, Glycosaminoglycan And Integrin Binding.
Faseb J. V. 23 2490 2009
PubMed-ID: 19276170  |  Reference-DOI: 10.1096/FJ.08-128090

(-) Compounds

Molecule 1 - CARTILAGE OLIGOMERIC MATRIX PROTEIN
    ChainsA, B, C
    EngineeredYES
    Expression SystemDROSOPHILA
    Expression System PlasmidPMT/BIP/V5-HIS A
    Expression System StrainDROSOPHILA S2 CELL
    Expression System Taxid7215
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 225-757
    GeneCOMP, COMP(CARTILAGE OLIGOMERIC MATRIX PROTEIN)
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCOMP

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABC
Biological Unit 1 (1x)A  
Biological Unit 2 (1x) B 
Biological Unit 3 (1x)  C

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 110)

Asymmetric Unit (4, 110)
No.NameCountTypeFull Name
1CA88Ligand/IonCALCIUM ION
2MAN6Ligand/IonALPHA-D-MANNOSE
3NAG6Ligand/IonN-ACETYL-D-GLUCOSAMINE
4SO410Ligand/IonSULFATE ION
Biological Unit 1 (3, 9)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2MAN2Ligand/IonALPHA-D-MANNOSE
3NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
4SO45Ligand/IonSULFATE ION
Biological Unit 2 (3, 5)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2MAN1Ligand/IonALPHA-D-MANNOSE
3NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
4SO42Ligand/IonSULFATE ION
Biological Unit 3 (3, 8)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2MAN3Ligand/IonALPHA-D-MANNOSE
3NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
4SO43Ligand/IonSULFATE ION

(-) Sites  (108, 108)

Asymmetric Unit (108, 108)
No.NameEvidenceResiduesDescription
001AC1SOFTWAREGLN A:226 , GLU A:236 , GLN B:226 , GLN C:226BINDING SITE FOR RESIDUE CA A 800
002AC2SOFTWAREASP A:269 , ASP A:271 , ASP A:273 , PHE A:275 , ASP A:290BINDING SITE FOR RESIDUE CA A 801
003AC3SOFTWAREASP A:271 , ASP A:273 , ASP A:290 , CYS A:292 , VAL A:295 , ASN A:297BINDING SITE FOR RESIDUE CA A 802
004AC4SOFTWAREASP A:302 , ASP A:304 , ASP A:306 , ILE A:308 , ASP A:313 , ALA A:316BINDING SITE FOR RESIDUE CA A 803
005AC5SOFTWAREASP A:304 , ASP A:306 , ASP A:313 , ASP A:315BINDING SITE FOR RESIDUE CA A 804
006AC6SOFTWAREASP A:315 , ASP A:317 , ASP A:319 , VAL A:321 , ASP A:326BINDING SITE FOR RESIDUE CA A 805
007AC7SOFTWAREASP A:317 , ASP A:319 , ASP A:326 , CYS A:328 , VAL A:331 , ASN A:333BINDING SITE FOR RESIDUE CA A 806
008AC8SOFTWAREASN A:338 , ASP A:340 , ASP A:342 , TRP A:344 , ASP A:349BINDING SITE FOR RESIDUE CA A 807
009AC9SOFTWAREASP A:340 , ASP A:342 , ASP A:349 , CYS A:351 , GLN A:354 , ASN A:356BINDING SITE FOR RESIDUE CA A 808
010BC1SOFTWAREASP A:361 , ASP A:363 , ASP A:365 , ARG A:367 , ASP A:372 , ILE A:375BINDING SITE FOR RESIDUE CA A 809
011BC2SOFTWAREASP A:363 , ASP A:365 , ASP A:372 , ASP A:374BINDING SITE FOR RESIDUE CA A 810
012BC3SOFTWAREASP A:374 , ASP A:376 , ASP A:378 , ILE A:380 , ASP A:385BINDING SITE FOR RESIDUE CA A 811
013BC4SOFTWAREASP A:376 , ASP A:378 , ASP A:385 , CYS A:387 , VAL A:390 , PRO A:391 , ASN A:392BINDING SITE FOR RESIDUE CA A 812
014BC5SOFTWAREASP A:397 , ASP A:399 , ASP A:401 , ILE A:403 , ASP A:408 , CA A:814BINDING SITE FOR RESIDUE CA A 813
015BC6SOFTWAREASP A:399 , ASP A:401 , ASP A:408 , CYS A:410 , LYS A:413 , ASN A:415 , CA A:813BINDING SITE FOR RESIDUE CA A 814
016BC7SOFTWAREASP A:420 , ASP A:422 , ASP A:424 , VAL A:426 , ASP A:431BINDING SITE FOR RESIDUE CA A 815
017BC8SOFTWAREASP A:422 , ASP A:424 , ASP A:431 , ASP A:433BINDING SITE FOR RESIDUE CA A 816
018BC9SOFTWAREASP A:435 , ASP A:437 , ASP A:439 , HIS A:441 , ASP A:446BINDING SITE FOR RESIDUE CA A 817
019CC1SOFTWAREASP A:437 , ASP A:439 , ASP A:446 , CYS A:448 , VAL A:451 , ASN A:453BINDING SITE FOR RESIDUE CA A 818
020CC2SOFTWAREASP A:458 , ASP A:460 , ASP A:462 , GLN A:464 , ASP A:469BINDING SITE FOR RESIDUE CA A 819
021CC3SOFTWAREASP A:460 , ASP A:462 , ASP A:469 , ASP A:471 , ASN A:474BINDING SITE FOR RESIDUE CA A 820
022CC4SOFTWAREASP A:466 , ASP A:469 , ASP A:472 , ASP A:479BINDING SITE FOR RESIDUE CA A 821
023CC5SOFTWAREASP A:471 , ASP A:473 , ASP A:475 , VAL A:477 , ASP A:482 , CA A:823BINDING SITE FOR RESIDUE CA A 822
024CC6SOFTWAREASP A:473 , ASP A:475 , ASP A:482 , CYS A:484 , VAL A:487 , ASN A:489 , CA A:822BINDING SITE FOR RESIDUE CA A 823
025CC7SOFTWAREASP A:496 , ASP A:498 , VAL A:500 , GLY A:501 , GLN A:505BINDING SITE FOR RESIDUE CA A 824
026CC8SOFTWAREASP A:507 , ASP A:509 , ASP A:511 , VAL A:513 , ASP A:515 , ASP A:518BINDING SITE FOR RESIDUE CA A 825
027CC9SOFTWAREASP A:509 , ASP A:511 , ASP A:518 , CYS A:520 , ASN A:523 , VAL A:526BINDING SITE FOR RESIDUE CA A 826
028DC1SOFTWAREASN A:565 , ASP A:593 , ASP A:595 , SER A:728 , GLU C:341BINDING SITE FOR RESIDUE CA A 827
029DC2SOFTWAREVAL A:591 , ASP A:593 , GLN A:616 , ASP A:678 , HOH A:851BINDING SITE FOR RESIDUE CA A 828
030DC3SOFTWAREASP A:593 , ASP A:594 , ASP A:595 , GLN A:619 , GLU C:341BINDING SITE FOR RESIDUE CA A 829
031DC4SOFTWAREASP A:581 , GLN A:687 , ARG A:689 , ARG A:740 , ASN A:742 , THR A:744 , PRO A:746 , NAG A:902 , SO4 A:1003BINDING SITE FOR RESIDUE NAG A 901
032DC5SOFTWAREILE A:745 , GLU A:747 , NAG A:901 , MAN A:903 , SO4 A:1003BINDING SITE FOR RESIDUE NAG A 902
033DC6SOFTWARENAG A:902 , MAN A:904BINDING SITE FOR RESIDUE MAN A 903
034DC7SOFTWAREMAN A:903BINDING SITE FOR RESIDUE MAN A 904
035DC8SOFTWAREARG A:558 , ARG A:738BINDING SITE FOR RESIDUE SO4 A 1001
036DC9SOFTWARECYS A:229 , GLU A:236 , ARG A:251BINDING SITE FOR RESIDUE SO4 A 1002
037EC1SOFTWAREGLN A:687 , PRO A:746 , NAG A:901 , NAG A:902BINDING SITE FOR RESIDUE SO4 A 1003
038EC2SOFTWAREARG A:288BINDING SITE FOR RESIDUE SO4 A 1004
039EC3SOFTWAREASP B:269 , ASP B:271 , ASP B:273 , PHE B:275 , ASP B:290BINDING SITE FOR RESIDUE CA B 801
040EC4SOFTWAREASP B:271 , ASP B:273 , ASP B:290 , CYS B:292 , VAL B:295 , ASN B:297BINDING SITE FOR RESIDUE CA B 802
041EC5SOFTWAREASP B:302 , ASP B:304 , ASP B:306 , ILE B:308 , ASP B:313BINDING SITE FOR RESIDUE CA B 803
042EC6SOFTWAREASP B:304 , ASP B:306 , ASP B:313 , ASP B:315BINDING SITE FOR RESIDUE CA B 804
043EC7SOFTWAREASP B:315 , ASP B:317 , ASP B:319 , VAL B:321 , ASP B:326BINDING SITE FOR RESIDUE CA B 805
044EC8SOFTWAREASP B:317 , ASP B:319 , ASP B:326 , CYS B:328 , VAL B:331 , ARG B:332 , ASN B:333BINDING SITE FOR RESIDUE CA B 806
045EC9SOFTWAREASN B:338 , ASP B:340 , ASP B:342 , TRP B:344 , ASP B:349BINDING SITE FOR RESIDUE CA B 807
046FC1SOFTWAREASP B:340 , ASP B:342 , ASP B:349 , CYS B:351 , GLN B:354 , ASN B:356BINDING SITE FOR RESIDUE CA B 808
047FC2SOFTWAREASP B:361 , ASP B:363 , ASP B:365 , ARG B:367 , ASP B:372BINDING SITE FOR RESIDUE CA B 809
048FC3SOFTWAREASP B:363 , ASP B:365 , ASP B:372 , ASP B:374BINDING SITE FOR RESIDUE CA B 810
049FC4SOFTWAREASP B:374 , ASP B:376 , ASP B:378 , ILE B:380 , ASP B:385BINDING SITE FOR RESIDUE CA B 811
050FC5SOFTWAREASP B:376 , ASP B:378 , ASP B:385 , CYS B:387 , VAL B:390 , ASN B:392BINDING SITE FOR RESIDUE CA B 812
051FC6SOFTWAREASP B:397 , ASP B:399 , ASP B:401 , ILE B:403 , ASP B:405 , ASP B:408BINDING SITE FOR RESIDUE CA B 813
052FC7SOFTWAREASP B:399 , ASP B:401 , ASP B:408 , CYS B:410 , LYS B:413 , ASN B:415BINDING SITE FOR RESIDUE CA B 814
053FC8SOFTWAREASP B:420 , ASP B:422 , ASP B:424 , VAL B:426 , ASP B:431BINDING SITE FOR RESIDUE CA B 815
054FC9SOFTWAREASP B:422 , ASP B:424 , ASP B:431 , ASP B:433BINDING SITE FOR RESIDUE CA B 816
055GC1SOFTWAREASP B:435 , ASP B:437 , ASP B:439 , HIS B:441 , ASP B:446BINDING SITE FOR RESIDUE CA B 817
056GC2SOFTWAREASP B:437 , ASP B:439 , ASP B:446 , CYS B:448 , VAL B:451 , ASN B:453BINDING SITE FOR RESIDUE CA B 818
057GC3SOFTWAREASP B:458 , ASP B:460 , ASP B:462 , GLN B:464BINDING SITE FOR RESIDUE CA B 819
058GC4SOFTWAREASP B:460 , ASP B:462 , ASP B:469 , ASP B:471 , ASN B:474BINDING SITE FOR RESIDUE CA B 820
059GC5SOFTWAREASP B:466 , ASP B:469 , ASP B:472 , ASP B:479 , HOH B:852BINDING SITE FOR RESIDUE CA B 821
060GC6SOFTWAREASP B:471 , ASP B:473 , ASP B:475 , VAL B:477 , ASP B:482BINDING SITE FOR RESIDUE CA B 822
061GC7SOFTWAREASP B:473 , ASP B:475 , ASP B:482 , CYS B:484 , VAL B:487 , ASN B:489BINDING SITE FOR RESIDUE CA B 823
062GC8SOFTWAREASP B:494 , ASP B:496 , ASP B:498 , VAL B:500 , GLN B:505BINDING SITE FOR RESIDUE CA B 824
063GC9SOFTWAREASP B:507 , ASP B:509 , ASP B:511 , VAL B:513 , ASP B:518BINDING SITE FOR RESIDUE CA B 825
064HC1SOFTWAREASP B:509 , ASP B:511 , ASP B:518 , CYS B:520 , ASN B:523 , VAL B:526BINDING SITE FOR RESIDUE CA B 826
065HC2SOFTWAREGLU B:341 , ASN B:565 , ASP B:593 , ASP B:595 , SER B:728BINDING SITE FOR RESIDUE CA B 827
066HC3SOFTWAREVAL B:591 , ASP B:593 , GLN B:616 , ASP B:678 , HOH B:853BINDING SITE FOR RESIDUE CA B 828
067HC4SOFTWAREGLU B:341 , ASP B:593 , ASP B:594 , ASP B:595 , GLN B:619BINDING SITE FOR RESIDUE CA B 829
068HC5SOFTWAREASP B:581 , GLN B:687 , ARG B:689 , ASN B:742 , THR B:744 , PRO B:746 , NAG B:902BINDING SITE FOR RESIDUE NAG B 901
069HC6SOFTWAREGLU B:747 , NAG B:901 , MAN B:903BINDING SITE FOR RESIDUE NAG B 902
070HC7SOFTWARENAG B:902BINDING SITE FOR RESIDUE MAN B 903
071HC8SOFTWAREARG B:332 , ARG B:352 , SER B:353 , ARG B:367BINDING SITE FOR RESIDUE SO4 B 1001
072HC9SOFTWAREARG B:558 , ARG B:738BINDING SITE FOR RESIDUE SO4 B 1002
073IC1SOFTWAREASP C:269 , ASP C:271 , ASP C:273 , PHE C:275 , ASP C:290BINDING SITE FOR RESIDUE CA C 801
074IC2SOFTWAREASP C:271 , ASP C:273 , ASP C:290 , CYS C:292 , VAL C:295 , ASN C:297BINDING SITE FOR RESIDUE CA C 802
075IC3SOFTWAREASP C:302 , ASP C:304 , ASP C:306 , ILE C:308 , ASP C:313 , ALA C:316BINDING SITE FOR RESIDUE CA C 803
076IC4SOFTWAREASP C:304 , ASP C:306 , ASP C:313 , ASP C:315BINDING SITE FOR RESIDUE CA C 804
077IC5SOFTWAREASP C:315 , ASP C:317 , ASP C:319 , VAL C:321 , ASP C:326BINDING SITE FOR RESIDUE CA C 805
078IC6SOFTWAREASP C:317 , ASP C:319 , ASP C:326 , CYS C:328 , VAL C:331 , ASN C:333BINDING SITE FOR RESIDUE CA C 806
079IC7SOFTWAREASN C:338 , ASP C:340 , ASP C:342 , TRP C:344 , ASP C:349 , ARG C:352BINDING SITE FOR RESIDUE CA C 807
080IC8SOFTWAREASP C:340 , ASP C:342 , ASP C:349 , CYS C:351 , GLN C:354 , ASN C:356BINDING SITE FOR RESIDUE CA C 808
081IC9SOFTWAREASP C:361 , ASP C:363 , ASP C:365 , ARG C:367 , ASP C:372BINDING SITE FOR RESIDUE CA C 809
082JC1SOFTWAREASP C:363 , ASP C:372 , ASP C:374 , GLY C:377BINDING SITE FOR RESIDUE CA C 810
083JC2SOFTWAREASP C:374 , ASP C:376 , ASP C:378 , ILE C:380 , ASP C:385 , CA C:812BINDING SITE FOR RESIDUE CA C 811
084JC3SOFTWAREASP C:376 , ASP C:378 , ASP C:385 , CYS C:387 , VAL C:390 , ASN C:392 , CA C:811BINDING SITE FOR RESIDUE CA C 812
085JC4SOFTWAREASP C:397 , ASP C:399 , ASP C:401 , ILE C:403 , ASP C:405 , ASP C:408BINDING SITE FOR RESIDUE CA C 813
086JC5SOFTWAREASP C:399 , ASP C:401 , ASP C:408 , CYS C:410 , LYS C:413 , SER C:414 , ASN C:415BINDING SITE FOR RESIDUE CA C 814
087JC6SOFTWAREASP C:420 , ASP C:422 , ASP C:424 , VAL C:426 , ASP C:431BINDING SITE FOR RESIDUE CA C 815
088JC7SOFTWAREASP C:422 , ASP C:424 , ASP C:431 , ASP C:433BINDING SITE FOR RESIDUE CA C 816
089JC8SOFTWAREASP C:435 , ASP C:437 , ASP C:439 , HIS C:441 , ASP C:446BINDING SITE FOR RESIDUE CA C 817
090JC9SOFTWAREASP C:437 , ASP C:439 , ASP C:446 , CYS C:448 , VAL C:451 , PRO C:452 , ASN C:453BINDING SITE FOR RESIDUE CA C 818
091KC1SOFTWAREASP C:458 , ASP C:460 , ASP C:462 , GLN C:464 , ASP C:469BINDING SITE FOR RESIDUE CA C 819
092KC2SOFTWAREASP C:460 , ASP C:462 , ASP C:469 , ASP C:471 , ASN C:474BINDING SITE FOR RESIDUE CA C 820
093KC3SOFTWAREASP C:466 , ASP C:469 , ASP C:472 , ASP C:479 , HOH C:852BINDING SITE FOR RESIDUE CA C 821
094KC4SOFTWAREASP C:471 , ASP C:473 , ASP C:475 , VAL C:477 , ASP C:482 , CA C:823BINDING SITE FOR RESIDUE CA C 822
095KC5SOFTWAREASP C:473 , ASP C:475 , ASP C:482 , CYS C:484 , VAL C:487 , ASN C:489 , CA C:822BINDING SITE FOR RESIDUE CA C 823
096KC6SOFTWAREASP C:494 , ASP C:496 , ASP C:498 , VAL C:500 , GLY C:501 , GLN C:505BINDING SITE FOR RESIDUE CA C 824
097KC7SOFTWAREASP C:507 , ASP C:509 , ASP C:511 , VAL C:513 , ASP C:518BINDING SITE FOR RESIDUE CA C 825
098KC8SOFTWAREASP C:509 , ASP C:511 , ASP C:518 , CYS C:520 , ASN C:523 , VAL C:526BINDING SITE FOR RESIDUE CA C 826
099KC9SOFTWAREGLU A:341 , ASN C:565 , ASP C:593 , ASP C:595 , SER C:728BINDING SITE FOR RESIDUE CA C 827
100LC1SOFTWAREVAL C:591 , ASP C:593 , GLN C:616 , ASP C:678 , HOH C:851BINDING SITE FOR RESIDUE CA C 828
101LC2SOFTWAREGLU A:341 , ASP C:593 , ASP C:594 , ASP C:595 , GLN C:619BINDING SITE FOR RESIDUE CA C 829
102LC3SOFTWAREASP C:581 , ARG C:689 , ARG C:740 , ASN C:742 , THR C:744 , PRO C:746 , NAG C:902 , SO4 C:1003BINDING SITE FOR RESIDUE NAG C 901
103LC4SOFTWAREILE C:745 , GLU C:747 , NAG C:901 , MAN C:903 , MAN C:905 , SO4 C:1003BINDING SITE FOR RESIDUE NAG C 902
104LC5SOFTWAREGLU C:747 , NAG C:902 , MAN C:904 , MAN C:905BINDING SITE FOR RESIDUE MAN C 903
105LC6SOFTWAREGLU C:747 , MAN C:903BINDING SITE FOR RESIDUE MAN C 904
106LC7SOFTWAREASP C:242 , NAG C:902 , MAN C:903BINDING SITE FOR RESIDUE MAN C 905
107LC8SOFTWAREARG C:558 , ARG C:738BINDING SITE FOR RESIDUE SO4 C 1001
108LC9SOFTWAREPRO C:746 , NAG C:901 , NAG C:902BINDING SITE FOR RESIDUE SO4 C 1003

(-) SS Bonds  (36, 36)

Asymmetric Unit
No.Residues
1A:229 -A:243
2A:237 -A:253
3A:255 -A:266
4A:282 -A:287
5A:292 -A:312
6A:328 -A:348
7A:351 -A:371
8A:387 -A:407
9A:410 -A:430
10A:448 -A:468
11A:484 -A:504
12A:520 -A:741
13B:229 -B:243
14B:237 -B:253
15B:255 -B:266
16B:282 -B:287
17B:292 -B:312
18B:328 -B:348
19B:351 -B:371
20B:387 -B:407
21B:410 -B:430
22B:448 -B:468
23B:484 -B:504
24B:520 -B:741
25C:229 -C:243
26C:237 -C:253
27C:255 -C:266
28C:282 -C:287
29C:292 -C:312
30C:328 -C:348
31C:351 -C:371
32C:387 -C:407
33C:410 -C:430
34C:448 -C:468
35C:484 -C:504
36C:520 -C:741

(-) Cis Peptide Bonds  (3, 3)

Asymmetric Unit
No.Residues
1Asn A:625 -Pro A:626
2Asn B:625 -Pro B:626
3Asn C:625 -Pro C:626

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (61, 183)

Asymmetric Unit (61, 183)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_016258R224GCOMP_HUMANPolymorphism  ---A/B/CS224G
02UniProtVAR_066790P234SCOMP_HUMANDisease (PSACH)557483957A/B/CP234S
03UniProtVAR_026239P276RCOMP_HUMANDisease (EDM1)  ---A/B/CP276R
04UniProtVAR_016261R285PCOMP_HUMANPolymorphism  ---A/B/CR285P
05UniProtVAR_066791D290GCOMP_HUMANDisease (PSACH)  ---A/B/CD290G
06UniProtVAR_007614D290NCOMP_HUMANDisease (PSACH)  ---A/B/CD290N
07UniProtVAR_066792S298LCOMP_HUMANDisease (EDM1)  ---A/B/CS298L
08UniProtVAR_007615G299RCOMP_HUMANDisease (PSACH)  ---A/B/CG299R
09UniProtVAR_066793A311DCOMP_HUMANDisease (EDM1)  ---A/B/CA311D
10UniProtVAR_066794D317GCOMP_HUMANDisease (EDM1)  ---A/B/CD317G
11UniProtVAR_066795D326GCOMP_HUMANDisease (EDM1)  ---A/B/CD326G
12UniProtVAR_066796D326YCOMP_HUMANDisease (PSACH)  ---A/B/CD326Y
13UniProtVAR_007616C328RCOMP_HUMANDisease (PSACH)137852653A/B/CC328R
14UniProtVAR_007617D342YCOMP_HUMANDisease (EDM1)137852652A/B/CD342Y
15UniProtVAR_066798C348FCOMP_HUMANDisease (EDM1)  ---A/B/CC348F
16UniProtVAR_017102C348RCOMP_HUMANDisease (PSACH)137852656A/B/CC348R
17UniProtVAR_007618D349VCOMP_HUMANDisease (PSACH)  ---A/B/CD349V
18UniProtVAR_007619D361VCOMP_HUMANDisease (EDM1)  ---A/B/CD361V
19UniProtVAR_007620D361YCOMP_HUMANDisease (EDM1)  ---A/B/CD361Y
20UniProtVAR_007622C371SCOMP_HUMANDisease (EDM1)  ---A/B/CC371S
21UniProtVAR_066800C371YCOMP_HUMANDisease (EDM1)  ---A/B/CC371Y
22UniProtVAR_066801D374NCOMP_HUMANDisease (EDM1)  ---A/B/CD374N
23UniProtVAR_066802D376NCOMP_HUMANDisease (EDM1)  ---A/B/CD376N
24UniProtVAR_066803D378VCOMP_HUMANDisease (PSACH)  ---A/B/CD378V
25UniProtVAR_046796R381CCOMP_HUMANPolymorphism3179763A/B/CR381C
26UniProtVAR_066804D385NCOMP_HUMANDisease (EDM1)  ---A/B/CD385N
27UniProtVAR_066805D385YCOMP_HUMANDisease (EDM1)  ---A/B/CD385Y
28UniProtVAR_007625C387GCOMP_HUMANDisease (PSACH)  ---A/B/CC387G
29UniProtVAR_066807C387RCOMP_HUMANDisease (PSACH)  ---A/B/CC387R
30UniProtVAR_066808D397HCOMP_HUMANDisease (EDM1)  ---A/B/CD397H
31UniProtVAR_066810G404RCOMP_HUMANDisease (EDM1)  ---A/B/CG404R
32UniProtVAR_007627D408YCOMP_HUMANDisease (EDM1)  ---A/B/CD408Y
33UniProtVAR_066811C410YCOMP_HUMANDisease (EDM1)  ---A/B/CC410Y
34UniProtVAR_066812N415KCOMP_HUMANDisease (EDM1)  ---A/B/CN415K
35UniProtVAR_026240D420ACOMP_HUMANDisease (EDM1)  ---A/B/CD420A
36UniProtVAR_066813G427ECOMP_HUMANDisease (EDM1)  ---A/B/CG427E
37UniProtVAR_007628G440ECOMP_HUMANDisease (PSACH)  ---A/B/CG440E
38UniProtVAR_007629G440RCOMP_HUMANDisease (PSACH)  ---A/B/CG440R
39UniProtVAR_066815D446NCOMP_HUMANDisease (PSACH)  ---A/B/CD446N
40UniProtVAR_066816C448SCOMP_HUMANDisease (PSACH)  ---A/B/CC448S
41UniProtVAR_007630N453SCOMP_HUMANDisease (EDM1)28936668A/B/CN453S
42UniProtVAR_007632C468YCOMP_HUMANDisease (PSACH)137852651A/B/CC468Y
43UniProtVAR_007634D472YCOMP_HUMANDisease (PSACH)137852650A/B/CD472Y
44UniProtVAR_007635D473GCOMP_HUMANDisease (PSACH)28936669A/B/CD473G
45UniProtVAR_066819D473HCOMP_HUMANDisease (PSACH)  ---A/B/CD473H
46UniProtVAR_066820D475NCOMP_HUMANDisease (PSACH)  ---A/B/CD475N
47UniProtVAR_007637D482GCOMP_HUMANDisease (PSACH)  ---A/B/CD482G
48UniProtVAR_066821G501DCOMP_HUMANDisease (EDM1)  ---A/B/CG501D
49UniProtVAR_066822D507GCOMP_HUMANDisease (PSACH)  ---A/B/CD507G
50UniProtVAR_066823D511GCOMP_HUMANDisease (PSACH)  ---A/B/CD511G
51UniProtVAR_066824D515GCOMP_HUMANDisease (PSACH)  ---A/B/CD515G
52UniProtVAR_007639D518NCOMP_HUMANDisease (PSACH)  ---A/B/CD518N
53UniProtVAR_007640N523KCOMP_HUMANDisease (EDM1)137852654A/B/CN523K
54UniProtVAR_066825T529ICOMP_HUMANDisease (PSACH)312262903A/B/CT529I
55UniProtVAR_007641T585MCOMP_HUMANDisease (PSACH)312262900A/B/CT585M
56UniProtVAR_007642T585RCOMP_HUMANDisease (PSACH)312262900A/B/CT585R
57UniProtVAR_066826R718PCOMP_HUMANDisease (EDM1)149551600A/B/CR718P
58UniProtVAR_066827R718WCOMP_HUMANDisease (EDM1)28936368A/B/CR718W
59UniProtVAR_017103G719DCOMP_HUMANDisease (PSACH)137852655A/B/CG719D
60UniProtVAR_066828G719SCOMP_HUMANDisease (PSACH)312262904A/B/CG719S
61UniProtVAR_066829Q756RCOMP_HUMANPolymorphism61752496A/B/CQ756R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (61, 61)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_016258R224GCOMP_HUMANPolymorphism  ---AS224G
02UniProtVAR_066790P234SCOMP_HUMANDisease (PSACH)557483957AP234S
03UniProtVAR_026239P276RCOMP_HUMANDisease (EDM1)  ---AP276R
04UniProtVAR_016261R285PCOMP_HUMANPolymorphism  ---AR285P
05UniProtVAR_066791D290GCOMP_HUMANDisease (PSACH)  ---AD290G
06UniProtVAR_007614D290NCOMP_HUMANDisease (PSACH)  ---AD290N
07UniProtVAR_066792S298LCOMP_HUMANDisease (EDM1)  ---AS298L
08UniProtVAR_007615G299RCOMP_HUMANDisease (PSACH)  ---AG299R
09UniProtVAR_066793A311DCOMP_HUMANDisease (EDM1)  ---AA311D
10UniProtVAR_066794D317GCOMP_HUMANDisease (EDM1)  ---AD317G
11UniProtVAR_066795D326GCOMP_HUMANDisease (EDM1)  ---AD326G
12UniProtVAR_066796D326YCOMP_HUMANDisease (PSACH)  ---AD326Y
13UniProtVAR_007616C328RCOMP_HUMANDisease (PSACH)137852653AC328R
14UniProtVAR_007617D342YCOMP_HUMANDisease (EDM1)137852652AD342Y
15UniProtVAR_066798C348FCOMP_HUMANDisease (EDM1)  ---AC348F
16UniProtVAR_017102C348RCOMP_HUMANDisease (PSACH)137852656AC348R
17UniProtVAR_007618D349VCOMP_HUMANDisease (PSACH)  ---AD349V
18UniProtVAR_007619D361VCOMP_HUMANDisease (EDM1)  ---AD361V
19UniProtVAR_007620D361YCOMP_HUMANDisease (EDM1)  ---AD361Y
20UniProtVAR_007622C371SCOMP_HUMANDisease (EDM1)  ---AC371S
21UniProtVAR_066800C371YCOMP_HUMANDisease (EDM1)  ---AC371Y
22UniProtVAR_066801D374NCOMP_HUMANDisease (EDM1)  ---AD374N
23UniProtVAR_066802D376NCOMP_HUMANDisease (EDM1)  ---AD376N
24UniProtVAR_066803D378VCOMP_HUMANDisease (PSACH)  ---AD378V
25UniProtVAR_046796R381CCOMP_HUMANPolymorphism3179763AR381C
26UniProtVAR_066804D385NCOMP_HUMANDisease (EDM1)  ---AD385N
27UniProtVAR_066805D385YCOMP_HUMANDisease (EDM1)  ---AD385Y
28UniProtVAR_007625C387GCOMP_HUMANDisease (PSACH)  ---AC387G
29UniProtVAR_066807C387RCOMP_HUMANDisease (PSACH)  ---AC387R
30UniProtVAR_066808D397HCOMP_HUMANDisease (EDM1)  ---AD397H
31UniProtVAR_066810G404RCOMP_HUMANDisease (EDM1)  ---AG404R
32UniProtVAR_007627D408YCOMP_HUMANDisease (EDM1)  ---AD408Y
33UniProtVAR_066811C410YCOMP_HUMANDisease (EDM1)  ---AC410Y
34UniProtVAR_066812N415KCOMP_HUMANDisease (EDM1)  ---AN415K
35UniProtVAR_026240D420ACOMP_HUMANDisease (EDM1)  ---AD420A
36UniProtVAR_066813G427ECOMP_HUMANDisease (EDM1)  ---AG427E
37UniProtVAR_007628G440ECOMP_HUMANDisease (PSACH)  ---AG440E
38UniProtVAR_007629G440RCOMP_HUMANDisease (PSACH)  ---AG440R
39UniProtVAR_066815D446NCOMP_HUMANDisease (PSACH)  ---AD446N
40UniProtVAR_066816C448SCOMP_HUMANDisease (PSACH)  ---AC448S
41UniProtVAR_007630N453SCOMP_HUMANDisease (EDM1)28936668AN453S
42UniProtVAR_007632C468YCOMP_HUMANDisease (PSACH)137852651AC468Y
43UniProtVAR_007634D472YCOMP_HUMANDisease (PSACH)137852650AD472Y
44UniProtVAR_007635D473GCOMP_HUMANDisease (PSACH)28936669AD473G
45UniProtVAR_066819D473HCOMP_HUMANDisease (PSACH)  ---AD473H
46UniProtVAR_066820D475NCOMP_HUMANDisease (PSACH)  ---AD475N
47UniProtVAR_007637D482GCOMP_HUMANDisease (PSACH)  ---AD482G
48UniProtVAR_066821G501DCOMP_HUMANDisease (EDM1)  ---AG501D
49UniProtVAR_066822D507GCOMP_HUMANDisease (PSACH)  ---AD507G
50UniProtVAR_066823D511GCOMP_HUMANDisease (PSACH)  ---AD511G
51UniProtVAR_066824D515GCOMP_HUMANDisease (PSACH)  ---AD515G
52UniProtVAR_007639D518NCOMP_HUMANDisease (PSACH)  ---AD518N
53UniProtVAR_007640N523KCOMP_HUMANDisease (EDM1)137852654AN523K
54UniProtVAR_066825T529ICOMP_HUMANDisease (PSACH)312262903AT529I
55UniProtVAR_007641T585MCOMP_HUMANDisease (PSACH)312262900AT585M
56UniProtVAR_007642T585RCOMP_HUMANDisease (PSACH)312262900AT585R
57UniProtVAR_066826R718PCOMP_HUMANDisease (EDM1)149551600AR718P
58UniProtVAR_066827R718WCOMP_HUMANDisease (EDM1)28936368AR718W
59UniProtVAR_017103G719DCOMP_HUMANDisease (PSACH)137852655AG719D
60UniProtVAR_066828G719SCOMP_HUMANDisease (PSACH)312262904AG719S
61UniProtVAR_066829Q756RCOMP_HUMANPolymorphism61752496AQ756R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (61, 61)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_016258R224GCOMP_HUMANPolymorphism  ---BS224G
02UniProtVAR_066790P234SCOMP_HUMANDisease (PSACH)557483957BP234S
03UniProtVAR_026239P276RCOMP_HUMANDisease (EDM1)  ---BP276R
04UniProtVAR_016261R285PCOMP_HUMANPolymorphism  ---BR285P
05UniProtVAR_066791D290GCOMP_HUMANDisease (PSACH)  ---BD290G
06UniProtVAR_007614D290NCOMP_HUMANDisease (PSACH)  ---BD290N
07UniProtVAR_066792S298LCOMP_HUMANDisease (EDM1)  ---BS298L
08UniProtVAR_007615G299RCOMP_HUMANDisease (PSACH)  ---BG299R
09UniProtVAR_066793A311DCOMP_HUMANDisease (EDM1)  ---BA311D
10UniProtVAR_066794D317GCOMP_HUMANDisease (EDM1)  ---BD317G
11UniProtVAR_066795D326GCOMP_HUMANDisease (EDM1)  ---BD326G
12UniProtVAR_066796D326YCOMP_HUMANDisease (PSACH)  ---BD326Y
13UniProtVAR_007616C328RCOMP_HUMANDisease (PSACH)137852653BC328R
14UniProtVAR_007617D342YCOMP_HUMANDisease (EDM1)137852652BD342Y
15UniProtVAR_066798C348FCOMP_HUMANDisease (EDM1)  ---BC348F
16UniProtVAR_017102C348RCOMP_HUMANDisease (PSACH)137852656BC348R
17UniProtVAR_007618D349VCOMP_HUMANDisease (PSACH)  ---BD349V
18UniProtVAR_007619D361VCOMP_HUMANDisease (EDM1)  ---BD361V
19UniProtVAR_007620D361YCOMP_HUMANDisease (EDM1)  ---BD361Y
20UniProtVAR_007622C371SCOMP_HUMANDisease (EDM1)  ---BC371S
21UniProtVAR_066800C371YCOMP_HUMANDisease (EDM1)  ---BC371Y
22UniProtVAR_066801D374NCOMP_HUMANDisease (EDM1)  ---BD374N
23UniProtVAR_066802D376NCOMP_HUMANDisease (EDM1)  ---BD376N
24UniProtVAR_066803D378VCOMP_HUMANDisease (PSACH)  ---BD378V
25UniProtVAR_046796R381CCOMP_HUMANPolymorphism3179763BR381C
26UniProtVAR_066804D385NCOMP_HUMANDisease (EDM1)  ---BD385N
27UniProtVAR_066805D385YCOMP_HUMANDisease (EDM1)  ---BD385Y
28UniProtVAR_007625C387GCOMP_HUMANDisease (PSACH)  ---BC387G
29UniProtVAR_066807C387RCOMP_HUMANDisease (PSACH)  ---BC387R
30UniProtVAR_066808D397HCOMP_HUMANDisease (EDM1)  ---BD397H
31UniProtVAR_066810G404RCOMP_HUMANDisease (EDM1)  ---BG404R
32UniProtVAR_007627D408YCOMP_HUMANDisease (EDM1)  ---BD408Y
33UniProtVAR_066811C410YCOMP_HUMANDisease (EDM1)  ---BC410Y
34UniProtVAR_066812N415KCOMP_HUMANDisease (EDM1)  ---BN415K
35UniProtVAR_026240D420ACOMP_HUMANDisease (EDM1)  ---BD420A
36UniProtVAR_066813G427ECOMP_HUMANDisease (EDM1)  ---BG427E
37UniProtVAR_007628G440ECOMP_HUMANDisease (PSACH)  ---BG440E
38UniProtVAR_007629G440RCOMP_HUMANDisease (PSACH)  ---BG440R
39UniProtVAR_066815D446NCOMP_HUMANDisease (PSACH)  ---BD446N
40UniProtVAR_066816C448SCOMP_HUMANDisease (PSACH)  ---BC448S
41UniProtVAR_007630N453SCOMP_HUMANDisease (EDM1)28936668BN453S
42UniProtVAR_007632C468YCOMP_HUMANDisease (PSACH)137852651BC468Y
43UniProtVAR_007634D472YCOMP_HUMANDisease (PSACH)137852650BD472Y
44UniProtVAR_007635D473GCOMP_HUMANDisease (PSACH)28936669BD473G
45UniProtVAR_066819D473HCOMP_HUMANDisease (PSACH)  ---BD473H
46UniProtVAR_066820D475NCOMP_HUMANDisease (PSACH)  ---BD475N
47UniProtVAR_007637D482GCOMP_HUMANDisease (PSACH)  ---BD482G
48UniProtVAR_066821G501DCOMP_HUMANDisease (EDM1)  ---BG501D
49UniProtVAR_066822D507GCOMP_HUMANDisease (PSACH)  ---BD507G
50UniProtVAR_066823D511GCOMP_HUMANDisease (PSACH)  ---BD511G
51UniProtVAR_066824D515GCOMP_HUMANDisease (PSACH)  ---BD515G
52UniProtVAR_007639D518NCOMP_HUMANDisease (PSACH)  ---BD518N
53UniProtVAR_007640N523KCOMP_HUMANDisease (EDM1)137852654BN523K
54UniProtVAR_066825T529ICOMP_HUMANDisease (PSACH)312262903BT529I
55UniProtVAR_007641T585MCOMP_HUMANDisease (PSACH)312262900BT585M
56UniProtVAR_007642T585RCOMP_HUMANDisease (PSACH)312262900BT585R
57UniProtVAR_066826R718PCOMP_HUMANDisease (EDM1)149551600BR718P
58UniProtVAR_066827R718WCOMP_HUMANDisease (EDM1)28936368BR718W
59UniProtVAR_017103G719DCOMP_HUMANDisease (PSACH)137852655BG719D
60UniProtVAR_066828G719SCOMP_HUMANDisease (PSACH)312262904BG719S
61UniProtVAR_066829Q756RCOMP_HUMANPolymorphism61752496BQ756R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (61, 61)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_016258R224GCOMP_HUMANPolymorphism  ---CS224G
02UniProtVAR_066790P234SCOMP_HUMANDisease (PSACH)557483957CP234S
03UniProtVAR_026239P276RCOMP_HUMANDisease (EDM1)  ---CP276R
04UniProtVAR_016261R285PCOMP_HUMANPolymorphism  ---CR285P
05UniProtVAR_066791D290GCOMP_HUMANDisease (PSACH)  ---CD290G
06UniProtVAR_007614D290NCOMP_HUMANDisease (PSACH)  ---CD290N
07UniProtVAR_066792S298LCOMP_HUMANDisease (EDM1)  ---CS298L
08UniProtVAR_007615G299RCOMP_HUMANDisease (PSACH)  ---CG299R
09UniProtVAR_066793A311DCOMP_HUMANDisease (EDM1)  ---CA311D
10UniProtVAR_066794D317GCOMP_HUMANDisease (EDM1)  ---CD317G
11UniProtVAR_066795D326GCOMP_HUMANDisease (EDM1)  ---CD326G
12UniProtVAR_066796D326YCOMP_HUMANDisease (PSACH)  ---CD326Y
13UniProtVAR_007616C328RCOMP_HUMANDisease (PSACH)137852653CC328R
14UniProtVAR_007617D342YCOMP_HUMANDisease (EDM1)137852652CD342Y
15UniProtVAR_066798C348FCOMP_HUMANDisease (EDM1)  ---CC348F
16UniProtVAR_017102C348RCOMP_HUMANDisease (PSACH)137852656CC348R
17UniProtVAR_007618D349VCOMP_HUMANDisease (PSACH)  ---CD349V
18UniProtVAR_007619D361VCOMP_HUMANDisease (EDM1)  ---CD361V
19UniProtVAR_007620D361YCOMP_HUMANDisease (EDM1)  ---CD361Y
20UniProtVAR_007622C371SCOMP_HUMANDisease (EDM1)  ---CC371S
21UniProtVAR_066800C371YCOMP_HUMANDisease (EDM1)  ---CC371Y
22UniProtVAR_066801D374NCOMP_HUMANDisease (EDM1)  ---CD374N
23UniProtVAR_066802D376NCOMP_HUMANDisease (EDM1)  ---CD376N
24UniProtVAR_066803D378VCOMP_HUMANDisease (PSACH)  ---CD378V
25UniProtVAR_046796R381CCOMP_HUMANPolymorphism3179763CR381C
26UniProtVAR_066804D385NCOMP_HUMANDisease (EDM1)  ---CD385N
27UniProtVAR_066805D385YCOMP_HUMANDisease (EDM1)  ---CD385Y
28UniProtVAR_007625C387GCOMP_HUMANDisease (PSACH)  ---CC387G
29UniProtVAR_066807C387RCOMP_HUMANDisease (PSACH)  ---CC387R
30UniProtVAR_066808D397HCOMP_HUMANDisease (EDM1)  ---CD397H
31UniProtVAR_066810G404RCOMP_HUMANDisease (EDM1)  ---CG404R
32UniProtVAR_007627D408YCOMP_HUMANDisease (EDM1)  ---CD408Y
33UniProtVAR_066811C410YCOMP_HUMANDisease (EDM1)  ---CC410Y
34UniProtVAR_066812N415KCOMP_HUMANDisease (EDM1)  ---CN415K
35UniProtVAR_026240D420ACOMP_HUMANDisease (EDM1)  ---CD420A
36UniProtVAR_066813G427ECOMP_HUMANDisease (EDM1)  ---CG427E
37UniProtVAR_007628G440ECOMP_HUMANDisease (PSACH)  ---CG440E
38UniProtVAR_007629G440RCOMP_HUMANDisease (PSACH)  ---CG440R
39UniProtVAR_066815D446NCOMP_HUMANDisease (PSACH)  ---CD446N
40UniProtVAR_066816C448SCOMP_HUMANDisease (PSACH)  ---CC448S
41UniProtVAR_007630N453SCOMP_HUMANDisease (EDM1)28936668CN453S
42UniProtVAR_007632C468YCOMP_HUMANDisease (PSACH)137852651CC468Y
43UniProtVAR_007634D472YCOMP_HUMANDisease (PSACH)137852650CD472Y
44UniProtVAR_007635D473GCOMP_HUMANDisease (PSACH)28936669CD473G
45UniProtVAR_066819D473HCOMP_HUMANDisease (PSACH)  ---CD473H
46UniProtVAR_066820D475NCOMP_HUMANDisease (PSACH)  ---CD475N
47UniProtVAR_007637D482GCOMP_HUMANDisease (PSACH)  ---CD482G
48UniProtVAR_066821G501DCOMP_HUMANDisease (EDM1)  ---CG501D
49UniProtVAR_066822D507GCOMP_HUMANDisease (PSACH)  ---CD507G
50UniProtVAR_066823D511GCOMP_HUMANDisease (PSACH)  ---CD511G
51UniProtVAR_066824D515GCOMP_HUMANDisease (PSACH)  ---CD515G
52UniProtVAR_007639D518NCOMP_HUMANDisease (PSACH)  ---CD518N
53UniProtVAR_007640N523KCOMP_HUMANDisease (EDM1)137852654CN523K
54UniProtVAR_066825T529ICOMP_HUMANDisease (PSACH)312262903CT529I
55UniProtVAR_007641T585MCOMP_HUMANDisease (PSACH)312262900CT585M
56UniProtVAR_007642T585RCOMP_HUMANDisease (PSACH)312262900CT585R
57UniProtVAR_066826R718PCOMP_HUMANDisease (EDM1)149551600CR718P
58UniProtVAR_066827R718WCOMP_HUMANDisease (EDM1)28936368CR718W
59UniProtVAR_017103G719DCOMP_HUMANDisease (PSACH)137852655CG719D
60UniProtVAR_066828G719SCOMP_HUMANDisease (PSACH)312262904CG719S
61UniProtVAR_066829Q756RCOMP_HUMANPolymorphism61752496CQ756R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (4, 33)

Asymmetric Unit (4, 33)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EGF_3PS50026 EGF-like domain profile.COMP_HUMAN127-164
180-219
225-267
 
 
  3-
-
A:225-267
B:225-267
C:225-267
2EGF_2PS01186 EGF-like domain signature 2.COMP_HUMAN253-266
 
 
  3A:253-266
B:253-266
C:253-266
3TSP3PS51234 Thrombospondin type-3 (TSP3) repeat profile.COMP_HUMAN301-336
 
 
268-300
 
 
337-359
 
 
360-395
 
 
396-418
 
 
419-456
 
 
457-492
 
 
493-528
 
 
  24A:301-336
B:301-336
C:301-336
A:268-300
B:268-300
C:268-300
A:337-359
B:337-359
C:337-359
A:360-395
B:360-395
C:360-395
A:396-418
B:396-418
C:396-418
A:419-456
B:419-456
C:419-456
A:457-492
B:457-492
C:457-492
A:493-528
B:493-528
C:493-528
4TSP_CTERPS51236 Thrombospondin C-terminal domain profile.COMP_HUMAN532-746
 
 
  3A:532-746
B:532-746
C:532-746
Biological Unit 1 (4, 11)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EGF_3PS50026 EGF-like domain profile.COMP_HUMAN127-164
180-219
225-267
 
 
  1-
-
A:225-267
-
-
2EGF_2PS01186 EGF-like domain signature 2.COMP_HUMAN253-266
 
 
  1A:253-266
-
-
3TSP3PS51234 Thrombospondin type-3 (TSP3) repeat profile.COMP_HUMAN301-336
 
 
268-300
 
 
337-359
 
 
360-395
 
 
396-418
 
 
419-456
 
 
457-492
 
 
493-528
 
 
  8A:301-336
-
-
A:268-300
-
-
A:337-359
-
-
A:360-395
-
-
A:396-418
-
-
A:419-456
-
-
A:457-492
-
-
A:493-528
-
-
4TSP_CTERPS51236 Thrombospondin C-terminal domain profile.COMP_HUMAN532-746
 
 
  1A:532-746
-
-
Biological Unit 2 (4, 11)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EGF_3PS50026 EGF-like domain profile.COMP_HUMAN127-164
180-219
225-267
 
 
  1-
-
-
B:225-267
-
2EGF_2PS01186 EGF-like domain signature 2.COMP_HUMAN253-266
 
 
  1-
B:253-266
-
3TSP3PS51234 Thrombospondin type-3 (TSP3) repeat profile.COMP_HUMAN301-336
 
 
268-300
 
 
337-359
 
 
360-395
 
 
396-418
 
 
419-456
 
 
457-492
 
 
493-528
 
 
  8-
B:301-336
-
-
B:268-300
-
-
B:337-359
-
-
B:360-395
-
-
B:396-418
-
-
B:419-456
-
-
B:457-492
-
-
B:493-528
-
4TSP_CTERPS51236 Thrombospondin C-terminal domain profile.COMP_HUMAN532-746
 
 
  1-
B:532-746
-
Biological Unit 3 (4, 11)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EGF_3PS50026 EGF-like domain profile.COMP_HUMAN127-164
180-219
225-267
 
 
  1-
-
-
-
C:225-267
2EGF_2PS01186 EGF-like domain signature 2.COMP_HUMAN253-266
 
 
  1-
-
C:253-266
3TSP3PS51234 Thrombospondin type-3 (TSP3) repeat profile.COMP_HUMAN301-336
 
 
268-300
 
 
337-359
 
 
360-395
 
 
396-418
 
 
419-456
 
 
457-492
 
 
493-528
 
 
  8-
-
C:301-336
-
-
C:268-300
-
-
C:337-359
-
-
C:360-395
-
-
C:396-418
-
-
C:419-456
-
-
C:457-492
-
-
C:493-528
4TSP_CTERPS51236 Thrombospondin C-terminal domain profile.COMP_HUMAN532-746
 
 
  1-
-
C:532-746

(-) Exons   (0, 0)

(no "Exon" information available for 3FBY)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:535
 aligned with COMP_HUMAN | P49747 from UniProtKB/Swiss-Prot  Length:757

    Alignment length:535
                                   232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672       682       692       702       712       722       732       742       752     
           COMP_HUMAN   223 RRAQRFCPDGSPSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQADVDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA 757
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................eeeee.....eeeee...ee......ee...............hhhhh....................hhhhh........hhhhh..................hhhhh..................hhhhh...............................hhhhh.................................hhhhh...............................hhhhh...............................hhhhh...............eeeee............eee......eee......eeeeeeeee..eeeeeeeee.......eeeeeeeeee..eeeeeeee...ee.........ee....eeeeee.....hhhhhhhhhh.......eeeeee...........eeeeeeeeehhh.eeeeeeee..eeeee...ee......eeeeeeee....eeeeeeeeee.....hhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) -G---------S-----------------------------------------R--------P----G-------LR-----------D-----G--------G-R-------------Y-----FV-----------V---------S--N-N-V--C---N-G---------H------R---Y-Y----K----A------E------------E-----N-S----S--------------Y---YG-N------G------------------D-----G---G---G--N----K-----I-------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------------PD------------------------------------R- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------N-----------------------------------Y---------------------R------------Y---------Y-------------Y-R----------------------------------------------------R--------------------------------H---------------------------------------------------------------------------------------------------------------R------------------------------------------------------------------------------------------------------------------------------------WS-------------------------------------- SAPs(SNPs) (2)
                PROSITE (1) --EGF_3  PDB: A:225-267 UniProt: 225-267     TSP3  PDB: A:268-300             TSP3  PDB: A:301-336                TSP3  PDB: A:337-359   TSP3  PDB: A:360-395                TSP3  PDB: A:396-418   TSP3  PDB: A:419-456 UniProt: 419-456 TSP3  PDB: A:457-492                TSP3  PDB: A:493-528                ---TSP_CTER  PDB: A:532-746 UniProt: 532-746                                                                                                                                                                              ----------- PROSITE (1)
                PROSITE (2) ------------------------------EGF_2         ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3fby A 223 NSAQRFCPDGSPSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQADVDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA 757
                                   232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672       682       692       702       712       722       732       742       752     

Chain B from PDB  Type:PROTEIN  Length:535
 aligned with COMP_HUMAN | P49747 from UniProtKB/Swiss-Prot  Length:757

    Alignment length:535
                                   232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672       682       692       702       712       722       732       742       752     
           COMP_HUMAN   223 RRAQRFCPDGSPSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQADVDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA 757
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................eeeee.....eeeee...ee......ee...............hhhhh....................hhhhh........hhhhh..................hhhhh......................................................hhhhh.................................hhhhh..................hhhhh................................................................eeeee............eeee....eeee......eeeeeeeee..eeeeeeeee.......eeeeeeeeee..eeeeeeee...ee.........ee....eeeeee.....hhhhhhhhhh.......eeeeee...........eeeeeeeee....eeeeeeee..eeee....ee......eeeeeeee....eeeeeee........hhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) -G---------S-----------------------------------------R--------P----G-------LR-----------D-----G--------G-R-------------Y-----FV-----------V---------S--N-N-V--C---N-G---------H------R---Y-Y----K----A------E------------E-----N-S----S--------------Y---YG-N------G------------------D-----G---G---G--N----K-----I-------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------------PD------------------------------------R- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------N-----------------------------------Y---------------------R------------Y---------Y-------------Y-R----------------------------------------------------R--------------------------------H---------------------------------------------------------------------------------------------------------------R------------------------------------------------------------------------------------------------------------------------------------WS-------------------------------------- SAPs(SNPs) (2)
                PROSITE (1) --EGF_3  PDB: B:225-267 UniProt: 225-267     TSP3  PDB: B:268-300             TSP3  PDB: B:301-336                TSP3  PDB: B:337-359   TSP3  PDB: B:360-395                TSP3  PDB: B:396-418   TSP3  PDB: B:419-456 UniProt: 419-456 TSP3  PDB: B:457-492                TSP3  PDB: B:493-528                ---TSP_CTER  PDB: B:532-746 UniProt: 532-746                                                                                                                                                                              ----------- PROSITE (1)
                PROSITE (2) ------------------------------EGF_2         ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3fby B 223 NSAQRFCPDGSPSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQADVDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA 757
                                   232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672       682       692       702       712       722       732       742       752     

Chain C from PDB  Type:PROTEIN  Length:535
 aligned with COMP_HUMAN | P49747 from UniProtKB/Swiss-Prot  Length:757

    Alignment length:535
                                   232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672       682       692       702       712       722       732       742       752     
           COMP_HUMAN   223 RRAQRFCPDGSPSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQADVDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA 757
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..................eeeee.....eeeee...eee....eee...............hhhhh....................hhhhh........hhhhh..................hhhhh...............................hhhhh..................hhhhh.................................hhhhh..................hhhhh........hhhhh...................................................eeeee............eeee....eeee......eeeeeeeee..eeeeeeeee.......eeeeeeeeee..eeeeeeee...ee.........ee....eeeeee.....hhhhhhhhhh.......eeeeee...........eeeeeeeee....eeeeeeee..eeeee...ee......eeeeeeee....eeeeeeeeee.....hhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) -G---------S-----------------------------------------R--------P----G-------LR-----------D-----G--------G-R-------------Y-----FV-----------V---------S--N-N-V--C---N-G---------H------R---Y-Y----K----A------E------------E-----N-S----S--------------Y---YG-N------G------------------D-----G---G---G--N----K-----I-------------------------------------------------------M------------------------------------------------------------------------------------------------------------------------------------PD------------------------------------R- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------N-----------------------------------Y---------------------R------------Y---------Y-------------Y-R----------------------------------------------------R--------------------------------H---------------------------------------------------------------------------------------------------------------R------------------------------------------------------------------------------------------------------------------------------------WS-------------------------------------- SAPs(SNPs) (2)
                PROSITE (1) --EGF_3  PDB: C:225-267 UniProt: 225-267     TSP3  PDB: C:268-300             TSP3  PDB: C:301-336                TSP3  PDB: C:337-359   TSP3  PDB: C:360-395                TSP3  PDB: C:396-418   TSP3  PDB: C:419-456 UniProt: 419-456 TSP3  PDB: C:457-492                TSP3  PDB: C:493-528                ---TSP_CTER  PDB: C:532-746 UniProt: 532-746                                                                                                                                                                              ----------- PROSITE (1)
                PROSITE (2) ------------------------------EGF_2         ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3fby C 223 NSAQRFCPDGSPSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQADVDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA 757
                                   232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672       682       692       702       712       722       732       742       752     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3FBY)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3FBY)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3FBY)

(-) Gene Ontology  (20, 20)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C   (COMP_HUMAN | P49747)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0005518    collagen binding    Interacting selectively and non-covalently with collagen, a group of fibrous proteins of very high tensile strength that form the main component of connective tissue in animals. Collagen is highly enriched in glycine (some regions are 33% glycine) and proline, occurring predominantly as 3-hydroxyproline (about 20%).
    GO:0005201    extracellular matrix structural constituent    The action of a molecule that contributes to the structural integrity of the extracellular matrix.
    GO:0043395    heparan sulfate proteoglycan binding    Interacting selectively and non-covalently with a heparan sulfate proteoglycan, any proteoglycan containing heparan sulfate as the glycosaminoglycan carbohydrate unit.
    GO:0008201    heparin binding    Interacting selectively and non-covalently with heparin, any member of a group of glycosaminoglycans found mainly as an intracellular component of mast cells and which consist predominantly of alternating alpha-(1->4)-linked D-galactose and N-acetyl-D-glucosamine-6-sulfate residues.
    GO:0002020    protease binding    Interacting selectively and non-covalently with any protease or peptidase.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0009887    animal organ morphogenesis    Morphogenesis of an animal organ. An organ is defined as a tissue or set of tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
    GO:0030198    extracellular matrix organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
    GO:0003417    growth plate cartilage development    The process whose specific outcome is the progression of the cartilage that will provide a scaffold for mineralization of endochondral bones as they elongate or grow.
    GO:0060173    limb development    The process whose specific outcome is the progression of a limb over time, from its formation to the mature structure. A limb is an appendage of an animal used for locomotion or grasping. Examples include legs, arms or some types of fin.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0001501    skeletal system development    The process whose specific outcome is the progression of the skeleton over time, from its formation to the mature structure. The skeleton is the bony framework of the body in vertebrates (endoskeleton) or the hard outer envelope of insects (exoskeleton or dermoskeleton).
cellular component
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0031012    extracellular matrix    A structure lying external to one or more cells, which provides structural support for cells or tissues.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0005578    proteinaceous extracellular matrix    A layer consisting mainly of proteins (especially collagen) and glycosaminoglycans (mostly as proteoglycans) that forms a sheet underlying or overlying cells such as endothelial and epithelial cells. The proteins are secreted by cells in the vicinity. An example of this component is found in Mus musculus.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
    DC2  [ RasMol ]  +environment [ RasMol ]
    DC3  [ RasMol ]  +environment [ RasMol ]
    DC4  [ RasMol ]  +environment [ RasMol ]
    DC5  [ RasMol ]  +environment [ RasMol ]
    DC6  [ RasMol ]  +environment [ RasMol ]
    DC7  [ RasMol ]  +environment [ RasMol ]
    DC8  [ RasMol ]  +environment [ RasMol ]
    DC9  [ RasMol ]  +environment [ RasMol ]
    EC1  [ RasMol ]  +environment [ RasMol ]
    EC2  [ RasMol ]  +environment [ RasMol ]
    EC3  [ RasMol ]  +environment [ RasMol ]
    EC4  [ RasMol ]  +environment [ RasMol ]
    EC5  [ RasMol ]  +environment [ RasMol ]
    EC6  [ RasMol ]  +environment [ RasMol ]
    EC7  [ RasMol ]  +environment [ RasMol ]
    EC8  [ RasMol ]  +environment [ RasMol ]
    EC9  [ RasMol ]  +environment [ RasMol ]
    FC1  [ RasMol ]  +environment [ RasMol ]
    FC2  [ RasMol ]  +environment [ RasMol ]
    FC3  [ RasMol ]  +environment [ RasMol ]
    FC4  [ RasMol ]  +environment [ RasMol ]
    FC5  [ RasMol ]  +environment [ RasMol ]
    FC6  [ RasMol ]  +environment [ RasMol ]
    FC7  [ RasMol ]  +environment [ RasMol ]
    FC8  [ RasMol ]  +environment [ RasMol ]
    FC9  [ RasMol ]  +environment [ RasMol ]
    GC1  [ RasMol ]  +environment [ RasMol ]
    GC2  [ RasMol ]  +environment [ RasMol ]
    GC3  [ RasMol ]  +environment [ RasMol ]
    GC4  [ RasMol ]  +environment [ RasMol ]
    GC5  [ RasMol ]  +environment [ RasMol ]
    GC6  [ RasMol ]  +environment [ RasMol ]
    GC7  [ RasMol ]  +environment [ RasMol ]
    GC8  [ RasMol ]  +environment [ RasMol ]
    GC9  [ RasMol ]  +environment [ RasMol ]
    HC1  [ RasMol ]  +environment [ RasMol ]
    HC2  [ RasMol ]  +environment [ RasMol ]
    HC3  [ RasMol ]  +environment [ RasMol ]
    HC4  [ RasMol ]  +environment [ RasMol ]
    HC5  [ RasMol ]  +environment [ RasMol ]
    HC6  [ RasMol ]  +environment [ RasMol ]
    HC7  [ RasMol ]  +environment [ RasMol ]
    HC8  [ RasMol ]  +environment [ RasMol ]
    HC9  [ RasMol ]  +environment [ RasMol ]
    IC1  [ RasMol ]  +environment [ RasMol ]
    IC2  [ RasMol ]  +environment [ RasMol ]
    IC3  [ RasMol ]  +environment [ RasMol ]
    IC4  [ RasMol ]  +environment [ RasMol ]
    IC5  [ RasMol ]  +environment [ RasMol ]
    IC6  [ RasMol ]  +environment [ RasMol ]
    IC7  [ RasMol ]  +environment [ RasMol ]
    IC8  [ RasMol ]  +environment [ RasMol ]
    IC9  [ RasMol ]  +environment [ RasMol ]
    JC1  [ RasMol ]  +environment [ RasMol ]
    JC2  [ RasMol ]  +environment [ RasMol ]
    JC3  [ RasMol ]  +environment [ RasMol ]
    JC4  [ RasMol ]  +environment [ RasMol ]
    JC5  [ RasMol ]  +environment [ RasMol ]
    JC6  [ RasMol ]  +environment [ RasMol ]
    JC7  [ RasMol ]  +environment [ RasMol ]
    JC8  [ RasMol ]  +environment [ RasMol ]
    JC9  [ RasMol ]  +environment [ RasMol ]
    KC1  [ RasMol ]  +environment [ RasMol ]
    KC2  [ RasMol ]  +environment [ RasMol ]
    KC3  [ RasMol ]  +environment [ RasMol ]
    KC4  [ RasMol ]  +environment [ RasMol ]
    KC5  [ RasMol ]  +environment [ RasMol ]
    KC6  [ RasMol ]  +environment [ RasMol ]
    KC7  [ RasMol ]  +environment [ RasMol ]
    KC8  [ RasMol ]  +environment [ RasMol ]
    KC9  [ RasMol ]  +environment [ RasMol ]
    LC1  [ RasMol ]  +environment [ RasMol ]
    LC2  [ RasMol ]  +environment [ RasMol ]
    LC3  [ RasMol ]  +environment [ RasMol ]
    LC4  [ RasMol ]  +environment [ RasMol ]
    LC5  [ RasMol ]  +environment [ RasMol ]
    LC6  [ RasMol ]  +environment [ RasMol ]
    LC7  [ RasMol ]  +environment [ RasMol ]
    LC8  [ RasMol ]  +environment [ RasMol ]
    LC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:625 - Pro A:626   [ RasMol ]  
    Asn B:625 - Pro B:626   [ RasMol ]  
    Asn C:625 - Pro C:626   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3fby
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  COMP_HUMAN | P49747
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  132400
    Disease InformationOMIM
  177170
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  COMP_HUMAN | P49747
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3FBY)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3FBY)