Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
(-)Biological Unit 7
(-)Biological Unit 8
(-)Biological Unit 9
(-)Biological Unit 10
(-)Biological Unit 11
(-)Biological Unit 12
(-)Biological Unit 13
(-)Biological Unit 14
(-)Biological Unit 15
(-)Biological Unit 16
(-)Biological Unit 17
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)
Image Biological Unit 7
Biological Unit 7  (Jmol Viewer)
Image Biological Unit 8
Biological Unit 8  (Jmol Viewer)
Image Biological Unit 9
Biological Unit 9  (Jmol Viewer)
Image Biological Unit 10
Biological Unit 10  (Jmol Viewer)
Image Biological Unit 11
Biological Unit 11  (Jmol Viewer)
Image Biological Unit 12
Biological Unit 12  (Jmol Viewer)
Image Biological Unit 13
Biological Unit 13  (Jmol Viewer)
Image Biological Unit 14
Biological Unit 14  (Jmol Viewer)
Image Biological Unit 15
Biological Unit 15  (Jmol Viewer)
Image Biological Unit 16
Biological Unit 16  (Jmol Viewer)
Image Biological Unit 17
Biological Unit 17  (Jmol Viewer)

(-) Description

Title :  COMPLEX STRUCTURE OF INSULIN-LIKE GROWTH FACTOR RECEPTOR AND 3-CYANOQUINOLINE INHIBITOR
 
Authors :  W. Xu, L. M. Miller, S. C. Mayer, D. M. Berger, D. H. Boschelli, F. Boschel
Date :  04 Nov 08  (Deposition) - 30 Dec 08  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,R,S,T
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Biol. Unit 5:  E  (1x)
Biol. Unit 6:  F  (1x)
Biol. Unit 7:  G  (1x)
Biol. Unit 8:  H  (1x)
Biol. Unit 9:  I  (1x)
Biol. Unit 10:  J  (1x)
Biol. Unit 11:  K  (1x)
Biol. Unit 12:  M  (1x)
Biol. Unit 13:  L  (1x)
Biol. Unit 14:  R  (1x)
Biol. Unit 15:  S  (1x)
Biol. Unit 16:  T  (1x)
Biol. Unit 17:  C (1x),D (1x),G (1x),H (1x),K (1x),L (1x),M (1x),R (1x)
Keywords :  Igf-1R, Protein-Inhibitor Complex, Tyrosine Kinase, Atp-Binding, Cleavage On Pair Of Basic Residues, Disease Mutation, Glycoprotein, Membrane, Nucleotide-Binding, Phosphoprotein, Receptor, Transferase, Transmembrane, Tyrosine-Protein Kinase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. M. Miller, S. C. Mayer, D. M. Berger, D. H. Boschelli, F. Boschelli, L. Di, X. Du, M. Dutia, M. B. Floyd, M. Johnson, C. H. Kenny, G. Krishnamurthy, F. Moy, S. Petusky, D. Tkach, N. Torres, B. Wu, W. Xu
Lead Identification To Generate 3-Cyanoquinoline Inhibitors Of Insulin-Like Growth Factor Receptor (Igf-1R) For Potential Use In Cancer Treatment
Bioorg. Med. Chem. Lett. V. 19 62 2009
PubMed-ID: 19041240  |  Reference-DOI: 10.1016/J.BMCL.2008.11.037
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    ChainsA, B, C, D, E, F, G, H, I, J, K, M, L, R, S, T
    EC Number2.7.10.1
    EngineeredYES
    Expression SystemBACULOVIRUS
    FragmentIGF-1R KINASE DOMAIN, UNP RESIDUES 981-1286
    GeneIGF1R
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymINSULIN-LIKE GROWTH FACTOR I RECEPTOR, IGF-I RECEPTOR, CD221 ANTIGEN

 Structural Features

(-) Chains, Units

  12345678910111213141516
Asymmetric Unit ABCDEFGHIJKLMRST
Biological Unit 1 (1x)A               
Biological Unit 2 (1x) B              
Biological Unit 3 (1x)  C             
Biological Unit 4 (1x)   D            
Biological Unit 5 (1x)    E           
Biological Unit 6 (1x)     F          
Biological Unit 7 (1x)      G         
Biological Unit 8 (1x)       H        
Biological Unit 9 (1x)        I       
Biological Unit 10 (1x)         J      
Biological Unit 11 (1x)          K     
Biological Unit 12 (1x)            M   
Biological Unit 13 (1x)           L    
Biological Unit 14 (1x)             R  
Biological Unit 15 (1x)              S 
Biological Unit 16 (1x)               T
Biological Unit 17 (1x)  C (1x)D (1x)  G (1x)H (1x)  K (1x)L (1x)M (1x)R (1x)  

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 64)

Asymmetric Unit (2, 64)
No.NameCountTypeFull Name
174116Ligand/Ion4-[[3-CHLORO-4-(1-METHYLIMIDAZOL-2-YL)SULFANYL-PHENYL]AMINO]-7-[3-(2-HYDROXYETHYL-METHYL-AMINO)PROPOXY]-6-METHOXY-QUINOLINE-3-CARBONITRILE
2PTR48Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
17411Ligand/Ion4-[[3-CHLORO-4-(1-METHYLIMIDAZOL-2-YL)SULFANYL-PHENYL]AMINO]-7-[3-(2-HYDROXYETHYL-METHYL-AMINO)PROPOXY]-6-METHOXY-QUINOLINE-3-CARBONITRILE
2PTR3Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 2 (2, 4)
No.NameCountTypeFull Name
17411Ligand/Ion4-[[3-CHLORO-4-(1-METHYLIMIDAZOL-2-YL)SULFANYL-PHENYL]AMINO]-7-[3-(2-HYDROXYETHYL-METHYL-AMINO)PROPOXY]-6-METHOXY-QUINOLINE-3-CARBONITRILE
2PTR3Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 3 (2, 4)
No.NameCountTypeFull Name
17411Ligand/Ion4-[[3-CHLORO-4-(1-METHYLIMIDAZOL-2-YL)SULFANYL-PHENYL]AMINO]-7-[3-(2-HYDROXYETHYL-METHYL-AMINO)PROPOXY]-6-METHOXY-QUINOLINE-3-CARBONITRILE
2PTR3Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 4 (2, 4)
No.NameCountTypeFull Name
17411Ligand/Ion4-[[3-CHLORO-4-(1-METHYLIMIDAZOL-2-YL)SULFANYL-PHENYL]AMINO]-7-[3-(2-HYDROXYETHYL-METHYL-AMINO)PROPOXY]-6-METHOXY-QUINOLINE-3-CARBONITRILE
2PTR3Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 5 (2, 4)
No.NameCountTypeFull Name
17411Ligand/Ion4-[[3-CHLORO-4-(1-METHYLIMIDAZOL-2-YL)SULFANYL-PHENYL]AMINO]-7-[3-(2-HYDROXYETHYL-METHYL-AMINO)PROPOXY]-6-METHOXY-QUINOLINE-3-CARBONITRILE
2PTR3Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 6 (2, 4)
No.NameCountTypeFull Name
17411Ligand/Ion4-[[3-CHLORO-4-(1-METHYLIMIDAZOL-2-YL)SULFANYL-PHENYL]AMINO]-7-[3-(2-HYDROXYETHYL-METHYL-AMINO)PROPOXY]-6-METHOXY-QUINOLINE-3-CARBONITRILE
2PTR3Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 7 (2, 4)
No.NameCountTypeFull Name
17411Ligand/Ion4-[[3-CHLORO-4-(1-METHYLIMIDAZOL-2-YL)SULFANYL-PHENYL]AMINO]-7-[3-(2-HYDROXYETHYL-METHYL-AMINO)PROPOXY]-6-METHOXY-QUINOLINE-3-CARBONITRILE
2PTR3Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 8 (2, 4)
No.NameCountTypeFull Name
17411Ligand/Ion4-[[3-CHLORO-4-(1-METHYLIMIDAZOL-2-YL)SULFANYL-PHENYL]AMINO]-7-[3-(2-HYDROXYETHYL-METHYL-AMINO)PROPOXY]-6-METHOXY-QUINOLINE-3-CARBONITRILE
2PTR3Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 9 (2, 4)
No.NameCountTypeFull Name
17411Ligand/Ion4-[[3-CHLORO-4-(1-METHYLIMIDAZOL-2-YL)SULFANYL-PHENYL]AMINO]-7-[3-(2-HYDROXYETHYL-METHYL-AMINO)PROPOXY]-6-METHOXY-QUINOLINE-3-CARBONITRILE
2PTR3Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 10 (2, 4)
No.NameCountTypeFull Name
17411Ligand/Ion4-[[3-CHLORO-4-(1-METHYLIMIDAZOL-2-YL)SULFANYL-PHENYL]AMINO]-7-[3-(2-HYDROXYETHYL-METHYL-AMINO)PROPOXY]-6-METHOXY-QUINOLINE-3-CARBONITRILE
2PTR3Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 11 (2, 4)
No.NameCountTypeFull Name
17411Ligand/Ion4-[[3-CHLORO-4-(1-METHYLIMIDAZOL-2-YL)SULFANYL-PHENYL]AMINO]-7-[3-(2-HYDROXYETHYL-METHYL-AMINO)PROPOXY]-6-METHOXY-QUINOLINE-3-CARBONITRILE
2PTR3Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 12 (2, 4)
No.NameCountTypeFull Name
17411Ligand/Ion4-[[3-CHLORO-4-(1-METHYLIMIDAZOL-2-YL)SULFANYL-PHENYL]AMINO]-7-[3-(2-HYDROXYETHYL-METHYL-AMINO)PROPOXY]-6-METHOXY-QUINOLINE-3-CARBONITRILE
2PTR3Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 13 (2, 4)
No.NameCountTypeFull Name
17411Ligand/Ion4-[[3-CHLORO-4-(1-METHYLIMIDAZOL-2-YL)SULFANYL-PHENYL]AMINO]-7-[3-(2-HYDROXYETHYL-METHYL-AMINO)PROPOXY]-6-METHOXY-QUINOLINE-3-CARBONITRILE
2PTR3Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 14 (2, 4)
No.NameCountTypeFull Name
17411Ligand/Ion4-[[3-CHLORO-4-(1-METHYLIMIDAZOL-2-YL)SULFANYL-PHENYL]AMINO]-7-[3-(2-HYDROXYETHYL-METHYL-AMINO)PROPOXY]-6-METHOXY-QUINOLINE-3-CARBONITRILE
2PTR3Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 15 (2, 4)
No.NameCountTypeFull Name
17411Ligand/Ion4-[[3-CHLORO-4-(1-METHYLIMIDAZOL-2-YL)SULFANYL-PHENYL]AMINO]-7-[3-(2-HYDROXYETHYL-METHYL-AMINO)PROPOXY]-6-METHOXY-QUINOLINE-3-CARBONITRILE
2PTR3Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 16 (2, 4)
No.NameCountTypeFull Name
17411Ligand/Ion4-[[3-CHLORO-4-(1-METHYLIMIDAZOL-2-YL)SULFANYL-PHENYL]AMINO]-7-[3-(2-HYDROXYETHYL-METHYL-AMINO)PROPOXY]-6-METHOXY-QUINOLINE-3-CARBONITRILE
2PTR3Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 17 (2, 16)
No.NameCountTypeFull Name
17414Ligand/Ion4-[[3-CHLORO-4-(1-METHYLIMIDAZOL-2-YL)SULFANYL-PHENYL]AMINO]-7-[3-(2-HYDROXYETHYL-METHYL-AMINO)PROPOXY]-6-METHOXY-QUINOLINE-3-CARBONITRILE
2PTR12Mod. Amino AcidO-PHOSPHOTYROSINE

(-) Sites  (16, 16)

Asymmetric Unit (16, 16)
No.NameEvidenceResiduesDescription
01AC1SOFTWARELEU A:1005 , SER A:1009 , ALA A:1031 , LYS A:1033 , PHE A:1047 , GLU A:1050 , VAL A:1063 , VAL A:1077 , MET A:1079 , GLU A:1080 , MET A:1082 , THR A:1083 , MET A:1142BINDING SITE FOR RESIDUE 741 A 1
02AC2SOFTWAREALA B:1031 , LYS B:1033 , PHE B:1047 , GLU B:1050 , VAL B:1063 , VAL B:1077 , MET B:1079 , GLU B:1080 , LEU B:1081 , MET B:1082 , THR B:1083 , GLY B:1085BINDING SITE FOR RESIDUE 741 B 2
03AC3SOFTWARELEU C:1005 , SER C:1009 , ALA C:1031 , LYS C:1033 , PHE C:1047 , GLU C:1050 , MET C:1054 , VAL C:1077 , MET C:1079 , GLU C:1080 , MET C:1082 , THR C:1083 , MET C:1142BINDING SITE FOR RESIDUE 741 C 3
04AC4SOFTWARELEU D:1005 , SER D:1009 , ALA D:1031 , LYS D:1033 , PHE D:1047 , GLU D:1050 , MET D:1054 , VAL D:1063 , VAL D:1077 , MET D:1079 , GLU D:1080 , LEU D:1081 , MET D:1082 , THR D:1083 , MET D:1142BINDING SITE FOR RESIDUE 741 D 4
05AC5SOFTWARELEU E:1005 , SER E:1009 , ALA E:1031 , LYS E:1033 , PHE E:1047 , GLU E:1050 , MET E:1054 , VAL E:1077 , MET E:1079 , GLU E:1080 , LEU E:1081 , MET E:1082 , THR E:1083 , ARG E:1084 , GLY E:1085 , MET E:1142BINDING SITE FOR RESIDUE 741 E 5
06AC6SOFTWARELEU F:1005 , SER F:1009 , VAL F:1013 , ALA F:1031 , LYS F:1033 , GLU F:1050 , MET F:1054 , VAL F:1077 , MET F:1079 , GLU F:1080 , LEU F:1081 , MET F:1082 , THR F:1083 , MET F:1142BINDING SITE FOR RESIDUE 741 F 6
07AC7SOFTWARELEU G:1005 , SER G:1009 , VAL G:1013 , LYS G:1033 , PHE G:1047 , GLU G:1050 , VAL G:1063 , VAL G:1077 , MET G:1079 , GLU G:1080 , LEU G:1081 , MET G:1082 , THR G:1083 , GLY G:1085 , MET G:1142BINDING SITE FOR RESIDUE 741 G 7
08AC8SOFTWARELEU H:1005 , SER H:1009 , VAL H:1013 , ALA H:1031 , LYS H:1033 , GLU H:1050 , MET H:1054 , VAL H:1077 , MET H:1079 , GLU H:1080 , MET H:1082 , THR H:1083 , MET H:1142BINDING SITE FOR RESIDUE 741 H 8
09AC9SOFTWARELEU I:1005 , SER I:1009 , LYS I:1033 , PHE I:1047 , GLU I:1050 , VAL I:1077 , MET I:1079 , GLU I:1080 , MET I:1082 , THR I:1083 , MET I:1142BINDING SITE FOR RESIDUE 741 I 9
10BC1SOFTWAREHOH J:111 , LEU J:1005 , SER J:1009 , ALA J:1031 , LYS J:1033 , PHE J:1047 , GLU J:1050 , MET J:1054 , VAL J:1077 , MET J:1079 , GLU J:1080 , LEU J:1081 , MET J:1082 , THR J:1083 , MET J:1142BINDING SITE FOR RESIDUE 741 J 10
11BC2SOFTWARELEU K:1005 , ALA K:1031 , LYS K:1033 , PHE K:1047 , GLU K:1050 , MET K:1054 , VAL K:1077 , MET K:1079 , GLU K:1080 , MET K:1082 , THR K:1083 , MET K:1142BINDING SITE FOR RESIDUE 741 K 11
12BC3SOFTWARELEU M:1005 , SER M:1009 , VAL M:1013 , ALA M:1031 , LYS M:1033 , PHE M:1047 , GLU M:1050 , VAL M:1077 , MET M:1079 , GLU M:1080 , LEU M:1081 , MET M:1082 , THR M:1083 , MET M:1142BINDING SITE FOR RESIDUE 741 M 12
13BC4SOFTWAREHOH L:156 , LEU L:1005 , SER L:1009 , VAL L:1013 , ALA L:1031 , LYS L:1033 , PHE L:1047 , MET L:1054 , VAL L:1077 , MET L:1079 , GLU L:1080 , LEU L:1081 , MET L:1082 , THR L:1083 , MET L:1142BINDING SITE FOR RESIDUE 741 L 13
14BC5SOFTWARELEU R:1005 , SER R:1009 , VAL R:1013 , LYS R:1033 , PHE R:1047 , GLU R:1050 , VAL R:1077 , MET R:1079 , GLU R:1080 , MET R:1082 , THR R:1083 , MET R:1142BINDING SITE FOR RESIDUE 741 R 14
15BC6SOFTWARELEU S:1005 , SER S:1009 , VAL S:1013 , ALA S:1031 , LYS S:1033 , PHE S:1047 , GLU S:1050 , MET S:1054 , VAL S:1077 , MET S:1079 , GLU S:1080 , LEU S:1081 , MET S:1082 , THR S:1083 , MET S:1142BINDING SITE FOR RESIDUE 741 S 15
16BC7SOFTWARELEU T:1005 , ALA T:1031 , LYS T:1033 , MET T:1054 , VAL T:1063 , VAL T:1077 , MET T:1079 , GLU T:1080 , MET T:1082 , THR T:1083 , MET T:1142BINDING SITE FOR RESIDUE 741 T 16

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3F5P)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Pro M:1106 -Pro M:1107

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 16)

Asymmetric Unit (1, 16)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---A/B/C/D/E/F/G/H/I/J/K/L/M/R/S/TR1256S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---AR1256S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---BR1256S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---CR1256S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---DR1256S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 5 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---ER1256S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 6 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---FR1256S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 7 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---GR1256S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 8 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---HR1256S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 9 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---IR1256S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 10 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---JR1256S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 11 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---KR1256S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 12 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---MR1256S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 13 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---LR1256S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 14 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---RR1256S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 15 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---SR1256S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 16 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---TR1256S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 17 (1, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_076249R1256SIGF1R_HUMANDisease (IGF1RES)  ---C/D/G/H/K/L/M/RR1256S

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 48)

Asymmetric Unit (3, 48)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  16A:1005-1033
B:1005-1033
C:1005-1033
D:1005-1033
E:1005-1033
F:1005-1033
G:1005-1033
H:1005-1033
I:1005-1033
J:1005-1033
K:1005-1033
L:1005-1033
M:1005-1033
R:1005-1033
S:1005-1033
T:1005-1033
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  16A:1131-1143
B:1131-1143
C:1131-1143
D:1131-1143
E:1131-1143
F:1131-1143
G:1131-1143
H:1131-1143
I:1131-1143
J:1131-1143
K:1131-1143
L:1131-1143
M:1131-1143
R:1131-1143
S:1131-1143
T:1131-1143
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  16A:1159-1167
B:1159-1167
C:1159-1167
D:1159-1167
E:1159-1167
F:1159-1167
G:1159-1167
H:1159-1167
I:1159-1167
J:1159-1167
K:1159-1167
L:1159-1167
M:1159-1167
R:1159-1167
S:1159-1167
T:1159-1167
Biological Unit 1 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1A:1005-1033
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1A:1131-1143
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1A:1159-1167
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
Biological Unit 2 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
B:1005-1033
-
-
-
-
-
-
-
-
-
-
-
-
-
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
B:1131-1143
-
-
-
-
-
-
-
-
-
-
-
-
-
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
B:1159-1167
-
-
-
-
-
-
-
-
-
-
-
-
-
-
Biological Unit 3 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
C:1005-1033
-
-
-
-
-
-
-
-
-
-
-
-
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
C:1131-1143
-
-
-
-
-
-
-
-
-
-
-
-
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
C:1159-1167
-
-
-
-
-
-
-
-
-
-
-
-
-
Biological Unit 4 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
D:1005-1033
-
-
-
-
-
-
-
-
-
-
-
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
D:1131-1143
-
-
-
-
-
-
-
-
-
-
-
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
D:1159-1167
-
-
-
-
-
-
-
-
-
-
-
-
Biological Unit 5 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
E:1005-1033
-
-
-
-
-
-
-
-
-
-
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
E:1131-1143
-
-
-
-
-
-
-
-
-
-
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
E:1159-1167
-
-
-
-
-
-
-
-
-
-
-
Biological Unit 6 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
F:1005-1033
-
-
-
-
-
-
-
-
-
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
F:1131-1143
-
-
-
-
-
-
-
-
-
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
F:1159-1167
-
-
-
-
-
-
-
-
-
-
Biological Unit 7 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
G:1005-1033
-
-
-
-
-
-
-
-
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
G:1131-1143
-
-
-
-
-
-
-
-
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
G:1159-1167
-
-
-
-
-
-
-
-
-
Biological Unit 8 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
H:1005-1033
-
-
-
-
-
-
-
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
H:1131-1143
-
-
-
-
-
-
-
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
H:1159-1167
-
-
-
-
-
-
-
-
Biological Unit 9 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
I:1005-1033
-
-
-
-
-
-
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
I:1131-1143
-
-
-
-
-
-
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
I:1159-1167
-
-
-
-
-
-
-
Biological Unit 10 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
J:1005-1033
-
-
-
-
-
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
J:1131-1143
-
-
-
-
-
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
J:1159-1167
-
-
-
-
-
-
Biological Unit 11 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
K:1005-1033
-
-
-
-
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
K:1131-1143
-
-
-
-
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
K:1159-1167
-
-
-
-
-
Biological Unit 12 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
M:1005-1033
-
-
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
M:1131-1143
-
-
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
M:1159-1167
-
-
-
Biological Unit 13 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
L:1005-1033
-
-
-
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
L:1131-1143
-
-
-
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
L:1159-1167
-
-
-
-
Biological Unit 14 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
R:1005-1033
-
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
R:1131-1143
-
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
R:1159-1167
-
-
Biological Unit 15 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
-
S:1005-1033
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
-
S:1131-1143
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
-
S:1159-1167
-
Biological Unit 16 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
T:1005-1033
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
T:1131-1143
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
T:1159-1167
Biological Unit 17 (3, 24)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.IGF1R_HUMAN1005-1033
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  8-
-
C:1005-1033
D:1005-1033
-
-
G:1005-1033
H:1005-1033
-
-
K:1005-1033
L:1005-1033
M:1005-1033
R:1005-1033
-
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.IGF1R_HUMAN1131-1143
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  8-
-
C:1131-1143
D:1131-1143
-
-
G:1131-1143
H:1131-1143
-
-
K:1131-1143
L:1131-1143
M:1131-1143
R:1131-1143
-
-
3RECEPTOR_TYR_KIN_IIPS00239 Receptor tyrosine kinase class II signature.IGF1R_HUMAN1159-1167
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  8-
-
C:1159-1167
D:1159-1167
-
-
G:1159-1167
H:1159-1167
-
-
K:1159-1167
L:1159-1167
M:1159-1167
R:1159-1167
-
-

(-) Exons   (7, 112)

Asymmetric Unit (7, 112)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002680351aENSE00001618814chr15:99192200-99192904705IGF1R_HUMAN1-32320--
1.2ENST000002680352ENSE00000943091chr15:99250791-99251336546IGF1R_HUMAN32-2141830--
1.3ENST000002680353ENSE00001320137chr15:99434554-99434866313IGF1R_HUMAN214-3181050--
1.4ENST000002680354ENSE00001129109chr15:99439986-99440134149IGF1R_HUMAN318-368510--
1.5ENST000002680355ENSE00001301974chr15:99442706-99442850145IGF1R_HUMAN368-416490--
1.6ENST000002680356ENSE00001129094chr15:99451914-99452128215IGF1R_HUMAN416-488730--
1.7ENST000002680357ENSE00001129087chr15:99454544-99454670127IGF1R_HUMAN488-530430--
1.8ENST000002680358ENSE00001129080chr15:99456273-99456511239IGF1R_HUMAN530-610810--
1.9ENST000002680359ENSE00001129073chr15:99459193-99459360168IGF1R_HUMAN610-666570--
1.10ENST0000026803510ENSE00001129062chr15:99459901-99460105205IGF1R_HUMAN666-734690--
1.11ENST0000026803511ENSE00001129055chr15:99465377-99465660284IGF1R_HUMAN734-829960--
1.12ENST0000026803512ENSE00001129044chr15:99467105-99467241137IGF1R_HUMAN829-874460--
1.13ENST0000026803513ENSE00001311160chr15:99467754-99467913160IGF1R_HUMAN875-928540--
1.14aENST0000026803514aENSE00001318374chr15:99472787-99472889103IGF1R_HUMAN928-962350--
1.15ENST0000026803515ENSE00001297944chr15:99473464-9947353471IGF1R_HUMAN962-9862516A:980-986
B:980-986
C:980-986
D:980-986
E:980-986
F:980-986
G:980-986
H:980-986
I:980-986
J:980-986
K:980-986
L:980-986
M:980-986
R:980-986
S:980-986
T:980-986
7
7
7
7
7
7
7
7
7
7
7
7
7
7
7
7
1.16ENST0000026803516ENSE00001129013chr15:99478053-99478282230IGF1R_HUMAN986-10627716A:986-1062
B:986-1062
C:986-1062
D:986-1062
E:986-1062
F:986-1062
G:986-1062
H:986-1062
I:986-1062
J:986-1062
K:986-1062
L:986-1062
M:986-1062
R:986-1062
S:986-1062
T:986-1062
77
77
77
77
77
77
77
77
77
77
77
77
77
77
77
77
1.17ENST0000026803517ENSE00001129006chr15:99478545-99478655111IGF1R_HUMAN1063-10993716A:1063-1098
B:1063-1097
C:1063-1098
D:1063-1096
E:1063-1097
F:1063-1097
G:1063-1097
H:1063-1098
I:1063-1096
J:1063-1096
K:1063-1096
L:1063-1096
M:1063-1096
R:1063-1096
S:1063-1096
T:1063-1096
36
35
36
34
35
35
35
36
34
34
34
34
34
34
34
34
1.18ENST0000026803518ENSE00001319679chr15:99482430-99482589160IGF1R_HUMAN1100-11535416A:1104-1153
B:1104-1153
C:1102-1153
D:1104-1153
E:1102-1153
F:1102-1153
G:1102-1153
H:1104-1153
I:1106-1153
J:1107-1153
K:1107-1153
L:1107-1153
M:1105-1153
R:1106-1153
S:1106-1153
T:1106-1153
50
50
52
50
52
52
52
50
48
47
47
47
49
48
48
48
1.19ENST0000026803519ENSE00001597369chr15:99486152-99486281130IGF1R_HUMAN1153-11964416A:1153-1196
B:1153-1196
C:1153-1196
D:1153-1196
E:1153-1196
F:1153-1196
G:1153-1196
H:1153-1196
I:1153-1196
J:1153-1196
K:1153-1196
L:1153-1196
M:1153-1196
R:1153-1196
S:1153-1196
T:1153-1196
44
44
44
44
44
44
44
44
44
44
44
44
44
44
44
44
1.20ENST0000026803520ENSE00001128979chr15:99491803-99491937135IGF1R_HUMAN1196-12414616A:1196-1241
B:1196-1241
C:1196-1241
D:1196-1241
E:1196-1241
F:1196-1241
G:1196-1241
H:1196-1241
I:1196-1241
J:1196-1241
K:1196-1241
L:1196-1241
M:1196-1241
R:1196-1241
S:1196-1241
T:1196-1241
46
46
46
46
46
46
46
46
46
46
46
46
46
46
46
46
1.21bENST0000026803521bENSE00001316091chr15:99500290-995077597470IGF1R_HUMAN1241-136712716A:1241-1286
B:1241-1286
C:1241-1286
D:1241-1286
E:1241-1285
F:1241-1285
G:1241-1285
H:1241-1286
I:1241-1285
J:1241-1285
K:1241-1285
L:1241-1285
M:1241-1285
R:1241-1285
S:1241-1286
T:1241-1286
46
46
46
46
45
45
45
46
45
45
45
45
45
45
46
46

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:302
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:307
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279       
         IGF1R_HUMAN    980 YFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
               SCOP domains d3f5pa_ A: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains 3f5pA01 A:980-1078 Phosphorylase Kinase; domain 1                                                  3f5pA02 A:1079-1279      Transferase(Phosphotransferase) domain 1                                                                                                                                        ------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh.....eeeeeeeeee..eeeeeeee..........eeeeeee....hhhhhhhhhhhhhhhhhh.......eeeee.....eeeeee.....hhhhhhhhh....-----....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------ SAPs(SNPs)
                    PROSITE -------------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15   ----------------------------------------------------------------------------Exon 1.17  PDB: A:1063-1098          Exon 1.18  PDB: A:1104-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: A:1196-1241 UniProt: 1196-1241--------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.16  PDB: A:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: A:1153-1196                 --------------------------------------------Exon 1.21b  PDB: A:1241-1286 [INCOMPLETE]      Transcript 1 (2)
                3f5p A  980 SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEM-----LAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIyETDyyRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089        |-    | 1109      1119      1129      1139      1149      1159 |   |1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279       
                                                                                                                                               1098  1104                                                     1161-PTR|                                                                                                                        
                                                                                                                                                                                                                  1165-PTR                                                                                                                     
                                                                                                                                                                                                                   1166-PTR                                                                                                                    

Chain B from PDB  Type:PROTEIN  Length:301
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:307
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279       
         IGF1R_HUMAN    980 YFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
               SCOP domains d3f5pb_ B: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains 3f5pB01 B:980-1078 Phosphorylase Kinase; domain 1                                                  3f5pB02 B:1079-1279       Transferase(Phosphotransferase) domain 1                                                                                                                                       ------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh.hhhhh.hhh.eeeeeeeee....eeeeeee..........eeeeeee....hhhhhhhhhhhhhhhh.........eeeee.....eeeeee.....hhhhhhhhh...------....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------ SAPs(SNPs)
                    PROSITE -------------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15   ----------------------------------------------------------------------------Exon 1.17  PDB: B:1063-1097          Exon 1.18  PDB: B:1104-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: B:1196-1241 UniProt: 1196-1241--------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.16  PDB: B:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: B:1153-1196                 --------------------------------------------Exon 1.21b  PDB: B:1241-1286 [INCOMPLETE]      Transcript 1 (2)
                3f5p B  980 SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPE------LAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIyETDyyRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089       | -    | 1109      1119      1129      1139      1149      1159 |   |1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279       
                                                                                                                                              1097   1104                                                     1161-PTR|                                                                                                                        
                                                                                                                                                                                                                  1165-PTR                                                                                                                     
                                                                                                                                                                                                                   1166-PTR                                                                                                                    

Chain C from PDB  Type:PROTEIN  Length:304
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:307
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279       
         IGF1R_HUMAN    980 YFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
               SCOP domains d3f5pc_ C: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains 3f5pC01 C:980-1078 Phosphorylase Kinase; domain 1                                                  3f5pC02 C:1079-1279    Transferase(Phosphotransferase) domain 1                                                                                                                                          ------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhh......hhh.eeeeeeeeee..eeeeeeee..........eeeeeee....hhhhhhhhhhhhhhhhhh.......eeeee.....eeeeee.....hhhhhhhhh....---......hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhh.........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------ SAPs(SNPs)
                    PROSITE -------------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15   ----------------------------------------------------------------------------Exon 1.17  PDB: C:1063-1098          Exon 1.18  PDB: C:1102-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: C:1196-1241 UniProt: 1196-1241--------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.16  PDB: C:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: C:1153-1196                 --------------------------------------------Exon 1.21b  PDB: C:1241-1286 [INCOMPLETE]      Transcript 1 (2)
                3f5p C  980 SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEM---PVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIyETDyyRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089        |-  |   1109      1119      1129      1139      1149      1159 |   |1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279       
                                                                                                                                               1098   |                                                       1161-PTR|                                                                                                                        
                                                                                                                                                   1102                                                           1165-PTR                                                                                                                     
                                                                                                                                                                                                                   1166-PTR                                                                                                                    

Chain D from PDB  Type:PROTEIN  Length:300
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:307
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279       
         IGF1R_HUMAN    980 YFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
               SCOP domains d3f5pd_ D: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains 3f5pD01 D:980-1078 Phosphorylase Kinase; domain 1                                                  3f5pD02 D:1079-127       9 Transferase(Phosphotransferase) domain 1                                                                                                                                      ------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhh..........eeeeeeeeee..eeeeeeee..........eeeeeee....hhhhhhhhhhhhhhhh.........eeeee.....eeeeee.....hhhhhhhhh..-------....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------ SAPs(SNPs)
                    PROSITE -------------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15   ----------------------------------------------------------------------------Exon 1.17  PDB: D:1063-1096          Exon 1.18  PDB: D:1104-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: D:1196-1241 UniProt: 1196-1241--------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.16  PDB: D:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: D:1153-1196                 --------------------------------------------Exon 1.21b  PDB: D:1241-1286 [INCOMPLETE]      Transcript 1 (2)
                3f5p D  980 SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRP-------LAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIyETDyyRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      |  -    | 1109      1119      1129      1139      1149      1159 |   |1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279       
                                                                                                                                             1096    1104                                                     1161-PTR|                                                                                                                        
                                                                                                                                                                                                                  1165-PTR                                                                                                                     
                                                                                                                                                                                                                   1166-PTR                                                                                                                    

Chain E from PDB  Type:PROTEIN  Length:302
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:306
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279      
         IGF1R_HUMAN    980 YFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN 1285
               SCOP domains d3f5pe_ E: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains 3f5pE01 E:980-1078 Phosphorylase Kinase; domain 1                                                  3f5pE02 E:1079-1279     Transferase(Phosphotransferase) domain 1                                                                                                                                         ------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhh.hhhhh.hhh.eeeeeeeeee..eeeeeeeeeeee..eeeeeeeeee.....hhhhhhhhhhhhhhhhhh.......eeeee......eeeee.....hhhhhhhh....----......hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S----------------------------- SAPs(SNPs)
                    PROSITE -------------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15   ----------------------------------------------------------------------------Exon 1.17  PDB: E:1063-1097          Exon 1.18  PDB: E:1102-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: E:1196-1241 UniProt: 1196-1241-------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.16  PDB: E:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: E:1153-1196                 --------------------------------------------Exon 1.21b  PDB: E:1241-1285 [INCOMPLETE]     Transcript 1 (2)
                3f5p E  980 SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPE----PVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIyETDyyRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN 1285
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089       | -  |   1109      1119      1129      1139      1149      1159 |   |1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279      
                                                                                                                                              1097 1102                                                       1161-PTR|                                                                                                                       
                                                                                                                                                                                                                  1165-PTR                                                                                                                    
                                                                                                                                                                                                                   1166-PTR                                                                                                                   

Chain F from PDB  Type:PROTEIN  Length:302
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:306
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279      
         IGF1R_HUMAN    980 YFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN 1285
               SCOP domains d3f5pf_ F: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains 3f5pF01 F:980-1078 Phosphorylase Kinase; domain 1                                                  3f5pF02 F:1079-1279     Transferase(Phosphotransferase) domain 1                                                                                                                                         ------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhh.......hhh.eeeeeeeeee..eeeeeeee..........eeeeeee.....hhhhhhhhhhhhhhh.........eeeee.....eeeeee.....hhhhhhhhh...----......hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S----------------------------- SAPs(SNPs)
                    PROSITE -------------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15   ----------------------------------------------------------------------------Exon 1.17  PDB: F:1063-1097          Exon 1.18  PDB: F:1102-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: F:1196-1241 UniProt: 1196-1241-------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.16  PDB: F:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: F:1153-1196                 --------------------------------------------Exon 1.21b  PDB: F:1241-1285 [INCOMPLETE]     Transcript 1 (2)
                3f5p F  980 SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPE----PVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIyETDyyRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN 1285
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089       | -  |   1109      1119      1129      1139      1149      1159 |   |1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279      
                                                                                                                                              1097 1102                                                       1161-PTR|                                                                                                                       
                                                                                                                                                                                                                  1165-PTR                                                                                                                    
                                                                                                                                                                                                                   1166-PTR                                                                                                                   

Chain G from PDB  Type:PROTEIN  Length:302
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:306
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279      
         IGF1R_HUMAN    980 YFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN 1285
               SCOP domains d3f5pg_ G: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains 3f5pG01 G:980-1078 Phosphorylase Kinase; domain 1                                                  3f5pG02 G:1079-1279     Transferase(Phosphotransferase) domain 1                                                                                                                                         ------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh.....eeeeeeeeee..eeeeeeeeeeee..eeeeeeeeeee....hhhhhhhhhhhhhhhhhh.......eeeee.....eeeeee.....hhhhhhhh....----......hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S----------------------------- SAPs(SNPs)
                    PROSITE -------------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15   ----------------------------------------------------------------------------Exon 1.17  PDB: G:1063-1097          Exon 1.18  PDB: G:1102-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: G:1196-1241 UniProt: 1196-1241-------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.16  PDB: G:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: G:1153-1196                 --------------------------------------------Exon 1.21b  PDB: G:1241-1285 [INCOMPLETE]     Transcript 1 (2)
                3f5p G  980 SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPE----PVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIyETDyyRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN 1285
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089       | -  |   1109      1119      1129      1139      1149      1159 |   |1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279      
                                                                                                                                              1097 1102                                                       1161-PTR|                                                                                                                       
                                                                                                                                                                                                                  1165-PTR                                                                                                                    
                                                                                                                                                                                                                   1166-PTR                                                                                                                   

Chain H from PDB  Type:PROTEIN  Length:302
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:307
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279       
         IGF1R_HUMAN    980 YFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
               SCOP domains d3f5ph_ H: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains 3f5pH01 H:980-1078 Phosphorylase Kinase; domain 1                                                  3f5pH02 H:1079-1279      Transferase(Phosphotransferase) domain 1                                                                                                                                        ------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhh......hhh.eeeeeeeeee..eeeeeeee..........eeeeeee....hhhhhhhhhhhhhhhhhh.......eeeee.....eeeeee.....hhhhhhhhh....-----....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------ SAPs(SNPs)
                    PROSITE -------------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15   ----------------------------------------------------------------------------Exon 1.17  PDB: H:1063-1098          Exon 1.18  PDB: H:1104-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: H:1196-1241 UniProt: 1196-1241--------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.16  PDB: H:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: H:1153-1196                 --------------------------------------------Exon 1.21b  PDB: H:1241-1286 [INCOMPLETE]      Transcript 1 (2)
                3f5p H  980 SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEM-----LAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIyETDyyRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089        |-    | 1109      1119      1129      1139      1149      1159 |   |1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279       
                                                                                                                                               1098  1104                                                     1161-PTR|                                                                                                                        
                                                                                                                                                                                                                  1165-PTR                                                                                                                     
                                                                                                                                                                                                                   1166-PTR                                                                                                                    

Chain I from PDB  Type:PROTEIN  Length:297
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:306
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279      
         IGF1R_HUMAN    980 YFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN 1285
               SCOP domains d3f5pi_ I: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains 3f5pI01 I:980-1078 Phosphorylase Kinase; domain 1                                                  3f5pI02 I:1079-127         9 Transferase(Phosphotransferase) domain 1                                                                                                                                    ------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhh.......hhh.eeeeeeeee....eeeeeeeeeee..eeeeeeeeeee....hhhhhhhhhhhhhhhh.........eeeee.....eeeeee.....hhhhhhhhh..---------..hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S----------------------------- SAPs(SNPs)
                    PROSITE -------------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15   ----------------------------------------------------------------------------Exon 1.17  PDB: I:1063-1096          Exon 1.18  PDB: I:1106-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: I:1196-1241 UniProt: 1196-1241-------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.16  PDB: I:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: I:1153-1196                 --------------------------------------------Exon 1.21b  PDB: I:1241-1285 [INCOMPLETE]     Transcript 1 (2)
                3f5p I  980 SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRP---------PPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIyETDyyRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN 1285
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      |  -      1109      1119      1129      1139      1149      1159 |   |1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279      
                                                                                                                                             1096      1106                                                   1161-PTR|                                                                                                                       
                                                                                                                                                                                                                  1165-PTR                                                                                                                    
                                                                                                                                                                                                                   1166-PTR                                                                                                                   

Chain J from PDB  Type:PROTEIN  Length:296
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:306
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279      
         IGF1R_HUMAN    980 YFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN 1285
               SCOP domains d3f5pj_ J: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains 3f5pJ01 J:980-1078 Phosphorylase Kinase; domain 1                                                  3f5pJ02 J:1079-127          9 Transferase(Phosphotransferase) domain 1                                                                                                                                   ------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhh......hhh.eeeeeeeee....eeeeeee..........eeeeeee....hhhhhhhhhhhhhhhhhh.......eeeee.....eeeeee.....hhhhhhhhh..----------.hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S----------------------------- SAPs(SNPs)
                    PROSITE -------------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15   ----------------------------------------------------------------------------Exon 1.17  PDB: J:1063-1096          Exon 1.18  PDB: J:1107-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: J:1196-1241 UniProt: 1196-1241-------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.16  PDB: J:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: J:1153-1196                 --------------------------------------------Exon 1.21b  PDB: J:1241-1285 [INCOMPLETE]     Transcript 1 (2)
                3f5p J  980 SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRP----------PSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIyETDyyRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN 1285
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      |  -      1109      1119      1129      1139      1149      1159 |   |1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279      
                                                                                                                                             1096       1107                                                  1161-PTR|                                                                                                                       
                                                                                                                                                                                                                  1165-PTR                                                                                                                    
                                                                                                                                                                                                                   1166-PTR                                                                                                                   

Chain K from PDB  Type:PROTEIN  Length:296
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:306
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279      
         IGF1R_HUMAN    980 YFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN 1285
               SCOP domains d3f5pk_ K: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains 3f5pK01 K:980-1078 Phosphorylase Kinase; domain 1                                                  3f5pK02 K:1079-127          9 Transferase(Phosphotransferase) domain 1                                                                                                                                   ------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhh.......hhh.eeeeeeeee....eeeeeee..........eeeeeee....hhhhhhhhhhhhhhhhhh.......eeeee.....eeeeee.....hhhhhhhhh..----------.hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S----------------------------- SAPs(SNPs)
                    PROSITE -------------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15   ----------------------------------------------------------------------------Exon 1.17  PDB: K:1063-1096          Exon 1.18  PDB: K:1107-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: K:1196-1241 UniProt: 1196-1241-------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.16  PDB: K:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: K:1153-1196                 --------------------------------------------Exon 1.21b  PDB: K:1241-1285 [INCOMPLETE]     Transcript 1 (2)
                3f5p K  980 SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRP----------PSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIyETDyyRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN 1285
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      |  -      1109      1119      1129      1139      1149      1159 |   |1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279      
                                                                                                                                             1096       1107                                                  1161-PTR|                                                                                                                       
                                                                                                                                                                                                                  1165-PTR                                                                                                                    
                                                                                                                                                                                                                   1166-PTR                                                                                                                   

Chain L from PDB  Type:PROTEIN  Length:296
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:306
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279      
         IGF1R_HUMAN    980 YFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN 1285
               SCOP domains d3f5pl_ L: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains 3f5pL01 L:980-1078 Phosphorylase Kinase; domain 1                                                  3f5pL02 L:1079-127          9 Transferase(Phosphotransferase) domain 1                                                                                                                                   ------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhh...........eeeeeeeee....eeeeeeee.......eeeeeeeee....hhhhhhhhhhhhhhhhhh.......eeeee.....eeeeee.....hhhhhhhhh..----------.hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S----------------------------- SAPs(SNPs)
                    PROSITE -------------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15   ----------------------------------------------------------------------------Exon 1.17  PDB: L:1063-1096          Exon 1.18  PDB: L:1107-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: L:1196-1241 UniProt: 1196-1241-------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.16  PDB: L:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: L:1153-1196                 --------------------------------------------Exon 1.21b  PDB: L:1241-1285 [INCOMPLETE]     Transcript 1 (2)
                3f5p L  980 SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRP----------PSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIyETDyyRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN 1285
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      |  -      1109      1119      1129      1139      1149      1159 |   |1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279      
                                                                                                                                             1096       1107                                                  1161-PTR|                                                                                                                       
                                                                                                                                                                                                                  1165-PTR                                                                                                                    
                                                                                                                                                                                                                   1166-PTR                                                                                                                   

Chain M from PDB  Type:PROTEIN  Length:298
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:306
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279      
         IGF1R_HUMAN    980 YFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN 1285
               SCOP domains d3f5pm_ M: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains 3f5pM01 M:980-1078 Phosphorylase Kinase; domain 1                                                  3f5pM02 M:1079-127        9 Transferase(Phosphotransferase) domain 1                                                                                                                                     ------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhh......hhh.eeeeeeeeee..eeeeeeeeeeee..eeeeeeeeeee....hhhhhhhhhhhhhhhhhh.......eeeee.....eeeeee.....hhhhhhhhh..--------...hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhhh........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S----------------------------- SAPs(SNPs)
                    PROSITE -------------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15   ----------------------------------------------------------------------------Exon 1.17  PDB: M:1063-1096          Exon 1.18  PDB: M:1105-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: M:1196-1241 UniProt: 1196-1241-------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.16  PDB: M:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: M:1153-1196                 --------------------------------------------Exon 1.21b  PDB: M:1241-1285 [INCOMPLETE]     Transcript 1 (2)
                3f5p M  980 SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRP--------APPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIyETDyyRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN 1285
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      |  -     |1109      1119      1129      1139      1149      1159 |   |1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279      
                                                                                                                                             1096     1105                                                    1161-PTR|                                                                                                                       
                                                                                                                                                                                                                  1165-PTR                                                                                                                    
                                                                                                                                                                                                                   1166-PTR                                                                                                                   

Chain R from PDB  Type:PROTEIN  Length:297
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:306
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279      
         IGF1R_HUMAN    980 YFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN 1285
               SCOP domains d3f5pr_ R: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains 3f5pR01 R:980-1078 Phosphorylase Kinase; domain 1                                                  3f5pR02 R:1079-127         9 Transferase(Phosphotransferase) domain 1                                                                                                                                    ------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhh.......hhh.eeeeeeeee....eeeeeee..........eeeeeee....hhhhhhhhhhhhhhhh.........eeeee.....eeeeee.....hhhhhhhhh..---------..hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S----------------------------- SAPs(SNPs)
                    PROSITE -------------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_---------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15   ----------------------------------------------------------------------------Exon 1.17  PDB: R:1063-1096          Exon 1.18  PDB: R:1106-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: R:1196-1241 UniProt: 1196-1241-------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.16  PDB: R:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: R:1153-1196                 --------------------------------------------Exon 1.21b  PDB: R:1241-1285 [INCOMPLETE]     Transcript 1 (2)
                3f5p R  980 SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRP---------PPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIyETDyyRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEEN 1285
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      |  -      1109      1119      1129      1139      1149      1159 |   |1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279      
                                                                                                                                             1096      1106                                                   1161-PTR|                                                                                                                       
                                                                                                                                                                                                                  1165-PTR                                                                                                                    
                                                                                                                                                                                                                   1166-PTR                                                                                                                   

Chain S from PDB  Type:PROTEIN  Length:298
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:307
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279       
         IGF1R_HUMAN    980 YFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
               SCOP domains d3f5ps_ S: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains 3f5pS01 S:980-1078 Phosphorylase Kinase; domain 1                                                  3f5pS02 S:1079-127         9 Transferase(Phosphotransferase) domain 1                                                                                                                                    ------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhh......hhh.eeeeeeeee....eeeeeeee.......eeeeeeeee....hhhhhhhhhhhhhhhhh........eeeee.....eeeeee.....hhhhhhhh...---------..hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------ SAPs(SNPs)
                    PROSITE -------------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15   ----------------------------------------------------------------------------Exon 1.17  PDB: S:1063-1096          Exon 1.18  PDB: S:1106-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: S:1196-1241 UniProt: 1196-1241--------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.16  PDB: S:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: S:1153-1196                 --------------------------------------------Exon 1.21b  PDB: S:1241-1286 [INCOMPLETE]      Transcript 1 (2)
                3f5p S  980 SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRP---------PPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIyETDyyRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      |  -      1109      1119      1129      1139      1149      1159 |   |1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279       
                                                                                                                                             1096      1106                                                   1161-PTR|                                                                                                                        
                                                                                                                                                                                                                  1165-PTR                                                                                                                     
                                                                                                                                                                                                                   1166-PTR                                                                                                                    

Chain T from PDB  Type:PROTEIN  Length:298
 aligned with IGF1R_HUMAN | P08069 from UniProtKB/Swiss-Prot  Length:1367

    Alignment length:307
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      1099      1109      1119      1129      1139      1149      1159      1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279       
         IGF1R_HUMAN    980 YFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
               SCOP domains d3f5pt_ T: Insulin-like growth factor 1 receptor                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains 3f5pT01 T:980-1078 Phosphorylase Kinase; domain 1                                                  3f5pT02 T:1079-127         9 Transferase(Phosphotransferase) domain 1                                                                                                                                    ------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh.hhh.eeeeeeeee....eeeeeeeeeee..eeeeeeeeeee....hhhhhhhhhhhhhhhhhh.......eeeee.....eeeeee.....hhhhhhhhh..---------..hhhhhhhhhhhhhhhhhhhhhh.ee........eee.....eee......ee......ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------ SAPs(SNPs)
                    PROSITE -------------------------PROTEIN_KINASE_ATP           -------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------RECEPTOR_----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15   ----------------------------------------------------------------------------Exon 1.17  PDB: T:1063-1096          Exon 1.18  PDB: T:1106-1153 UniProt: 1100-1153        ------------------------------------------Exon 1.20  PDB: T:1196-1241 UniProt: 1196-1241--------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.16  PDB: T:986-1062 UniProt: 986-1062                                 ------------------------------------------------------------------------------------------Exon 1.19  PDB: T:1153-1196                 --------------------------------------------Exon 1.21b  PDB: T:1241-1286 [INCOMPLETE]      Transcript 1 (2)
                3f5p T  980 SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRP---------PPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIyETDyyRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK 1286
                                   989       999      1009      1019      1029      1039      1049      1059      1069      1079      1089      |  -      1109      1119      1129      1139      1149      1159 |   |1169      1179      1189      1199      1209      1219      1229      1239      1249      1259      1269      1279       
                                                                                                                                             1096      1106                                                   1161-PTR|                                                                                                                        
                                                                                                                                                                                                                  1165-PTR                                                                                                                     
                                                                                                                                                                                                                   1166-PTR                                                                                                                    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 16)

Asymmetric Unit

(-) CATH Domains  (2, 32)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
1a3f5pA01A:980-1078
1b3f5pB01B:980-1078
1c3f5pC01C:980-1078
1d3f5pD01D:980-1078
1e3f5pE01E:980-1078
1f3f5pF01F:980-1078
1g3f5pG01G:980-1078
1h3f5pH01H:980-1078
1i3f5pI01I:980-1078
1j3f5pJ01J:980-1078
1k3f5pK01K:980-1078
1l3f5pL01L:980-1078
1m3f5pM01M:980-1078
1n3f5pR01R:980-1078
1o3f5pS01S:980-1078
1p3f5pT01T:980-1078
2a3f5pC02C:1079-1279
2b3f5pE02E:1079-1279
2c3f5pF02F:1079-1279
2d3f5pG02G:1079-1279
2e3f5pA02A:1079-1279
2f3f5pH02H:1079-1279
2g3f5pB02B:1079-1279
2h3f5pD02D:1079-1279
2i3f5pM02M:1079-1279
2j3f5pI02I:1079-1279
2k3f5pR02R:1079-1279
2l3f5pS02S:1079-1279
2m3f5pT02T:1079-1279
2n3f5pJ02J:1079-1279
2o3f5pK02K:1079-1279
2p3f5pL02L:1079-1279

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3F5P)

(-) Gene Ontology  (41, 41)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F,G,H,I,J,K,L,M,R,S,T   (IGF1R_HUMAN | P08069)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0043559    insulin binding    Interacting selectively and non-covalently with insulin, a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
    GO:0005158    insulin receptor binding    Interacting selectively and non-covalently with the insulin receptor.
    GO:0043560    insulin receptor substrate binding    Interacting selectively and non-covalently with any of the insulin receptor substrate (IRS) proteins, adaptor proteins that bind to the transphosphorylated insulin and insulin-like growth factor receptors, are themselves phosphorylated and in turn recruit SH2 domain-containing signaling molecules to form a productive signaling complex.
    GO:0031994    insulin-like growth factor I binding    Interacting selectively and non-covalently with insulin-like growth factor I.
    GO:0005520    insulin-like growth factor binding    Interacting selectively and non-covalently with an insulin-like growth factor, any member of a group of polypeptides that are structurally homologous to insulin and share many of its biological activities, but are immunologically distinct from it.
    GO:0005010    insulin-like growth factor-activated receptor activity    Combining with insulin-like growth factor and transmitting the signal across the plasma membrane to initiate a change in cell activity.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0043548    phosphatidylinositol 3-kinase binding    Interacting selectively and non-covalently with a phosphatidylinositol 3-kinase, any enzyme that catalyzes the addition of a phosphate group to an inositol lipid at the 3' position of the inositol ring.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004713    protein tyrosine kinase activity    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0004714    transmembrane receptor protein tyrosine kinase activity    Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
biological process
    GO:0006955    immune response    Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
    GO:0051389    inactivation of MAPKK activity    Any process that terminates the activity of the active enzyme MAP kinase kinase (MAPKK).
    GO:0008286    insulin receptor signaling pathway    The series of molecular signals generated as a consequence of the insulin receptor binding to insulin.
    GO:0048009    insulin-like growth factor receptor signaling pathway    The series of molecular signals generated as a consequence of the insulin-like growth factor receptor binding to one of its physiological ligands.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0038083    peptidyl-tyrosine autophosphorylation    The phosphorylation by a protein of one or more of its own tyrosine amino acid residues, or a tyrosine residue on an identical protein.
    GO:0014065    phosphatidylinositol 3-kinase signaling    A series of reactions within the signal-receiving cell, mediated by the intracellular phosphatidylinositol 3-kinase (PI3K). Many cell surface receptor linked signaling pathways signal through PI3K to regulate numerous cellular functions.
    GO:0048015    phosphatidylinositol-mediated signaling    A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0045740    positive regulation of DNA replication    Any process that activates or increases the frequency, rate or extent of DNA replication.
    GO:0030335    positive regulation of cell migration    Any process that activates or increases the frequency, rate or extent of cell migration.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0046777    protein autophosphorylation    The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0051262    protein tetramerization    The formation of a protein tetramer, a macromolecular structure consisting of four noncovalently associated identical or nonidentical subunits.
    GO:0046328    regulation of JNK cascade    Any process that modulates the frequency, rate or extent of signal transduction mediated by the JNK cascade.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0007169    transmembrane receptor protein tyrosine kinase signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
    GO:0035867    alphav-beta3 integrin-IGF-1-IGF1R complex    A protein complex that consists of an alphav-beta3 integrin complex bound to insulin-like growth factor-1 (IGF-1) and type I insulin-like growth factor receptor (IGF1R). IGF1R is a heterotetramer that consists of two alpha-subunits and two beta-subunits.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0043235    receptor complex    Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    741  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PTR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Pro M:1106 - Pro M:1107   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]
    Biological Unit 7  [ Jena3D ]
    Biological Unit 8  [ Jena3D ]
    Biological Unit 9  [ Jena3D ]
    Biological Unit 10  [ Jena3D ]
    Biological Unit 11  [ Jena3D ]
    Biological Unit 12  [ Jena3D ]
    Biological Unit 13  [ Jena3D ]
    Biological Unit 14  [ Jena3D ]
    Biological Unit 15  [ Jena3D ]
    Biological Unit 16  [ Jena3D ]
    Biological Unit 17  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3f5p
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IGF1R_HUMAN | P08069
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.10.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  270450
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  IGF1R_HUMAN | P08069
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IGF1R_HUMAN | P080691igr 1jqh 1k3a 1m7n 1p4o 2oj9 2zm3 3d94 3i81 3lvp 3lw0 3nw5 3nw6 3nw7 3o23 3qqu 4d2r 4xss 5fxq 5fxr 5fxs 5hzn

(-) Related Entries Specified in the PDB File

2zm3