Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
(-)Biological Unit 7
(-)Biological Unit 8
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)
Image Biological Unit 7
Biological Unit 7  (Jmol Viewer)
Image Biological Unit 8
Biological Unit 8  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN PAS KINASE BOUND TO ADP
 
Authors :  S. Antonysamy, J. B. Bonanno, R. Romero, M. Russell, M. Iizuka, T. Gheyi S. R. Wasserman, J. Rutter, J. M. Sauder, S. K. Burley, New York Sgx R Center For Structural Genomics (Nysgxrc)
Date :  29 Jun 08  (Deposition) - 26 Aug 08  (Release) - 19 Aug 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Biol. Unit 5:  E  (1x)
Biol. Unit 6:  F  (1x)
Biol. Unit 7:  A,B,C  (1x)
Biol. Unit 8:  D (1x),E (1x),F (1x)
Keywords :  Pas Kinase, Pask, Protein Kinase, Drug Discovery, Atp-Binding, Kinase, Nucleotide-Binding, Phosphoprotein, Serine/Threonine-Protein Kinase, Transferase, Structural Genomics, Psi-2, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. K. Kikani, S. A. Antonysamy, J. B. Bonanno, R. Romero, F. F. Zhang, M. Russell, T. Gheyi, M. Iizuka, S. Emtage, J. M. Sauder, B. E. Turk, S. K. Burley, J. Rutter
Structural Bases Of Pas Domain-Regulated Kinase (Pask) Activation In The Absence Of Activation Loop Phosphorylation.
J. Biol. Chem. V. 285 41034 2010
PubMed-ID: 20943661  |  Reference-DOI: 10.1074/JBC.M110.157594

(-) Compounds

Molecule 1 - PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN KINASE
    ChainsA, B, C, D, E, F
    EC Number2.7.11.1
    EngineeredYES
    Expression SystemBACULOVIRUS
    Expression System StrainSF9
    FragmentPROTEIN KINASE DOMAIN
    GenePASK, KIAA0135
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPAS-KINASE, PASKIN, HPASK

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit ABCDEF
Biological Unit 1 (1x)A     
Biological Unit 2 (1x) B    
Biological Unit 3 (1x)  C   
Biological Unit 4 (1x)   D  
Biological Unit 5 (1x)    E 
Biological Unit 6 (1x)     F
Biological Unit 7 (1x)ABC   
Biological Unit 8 (1x)   D (1x)E (1x)F (1x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 25)

Asymmetric Unit (2, 25)
No.NameCountTypeFull Name
1ADP6Ligand/IonADENOSINE-5'-DIPHOSPHATE
2MG19Ligand/IonMAGNESIUM ION
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1ADP1Ligand/IonADENOSINE-5'-DIPHOSPHATE
2MG-1Ligand/IonMAGNESIUM ION
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1ADP1Ligand/IonADENOSINE-5'-DIPHOSPHATE
2MG-1Ligand/IonMAGNESIUM ION
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
1ADP1Ligand/IonADENOSINE-5'-DIPHOSPHATE
2MG-1Ligand/IonMAGNESIUM ION
Biological Unit 4 (1, 1)
No.NameCountTypeFull Name
1ADP1Ligand/IonADENOSINE-5'-DIPHOSPHATE
2MG-1Ligand/IonMAGNESIUM ION
Biological Unit 5 (1, 1)
No.NameCountTypeFull Name
1ADP1Ligand/IonADENOSINE-5'-DIPHOSPHATE
2MG-1Ligand/IonMAGNESIUM ION
Biological Unit 6 (1, 1)
No.NameCountTypeFull Name
1ADP1Ligand/IonADENOSINE-5'-DIPHOSPHATE
2MG-1Ligand/IonMAGNESIUM ION
Biological Unit 7 (1, 3)
No.NameCountTypeFull Name
1ADP3Ligand/IonADENOSINE-5'-DIPHOSPHATE
2MG-1Ligand/IonMAGNESIUM ION
Biological Unit 8 (1, 1)
No.NameCountTypeFull Name
1ADP1Ligand/IonADENOSINE-5'-DIPHOSPHATE
2MG-1Ligand/IonMAGNESIUM ION

(-) Sites  (25, 25)

Asymmetric Unit (25, 25)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASN A:1133 , ASP A:1146BINDING SITE FOR RESIDUE MG A 7
02AC2SOFTWAREASP A:1146BINDING SITE FOR RESIDUE MG A 8
03AC3SOFTWAREASN B:1133 , ASP B:1146BINDING SITE FOR RESIDUE MG B 9
04AC4SOFTWAREASP B:1146BINDING SITE FOR RESIDUE MG B 10
05AC5SOFTWAREASN C:1133 , ASP C:1146BINDING SITE FOR RESIDUE MG C 11
06AC6SOFTWAREASP C:1146BINDING SITE FOR RESIDUE MG C 12
07AC7SOFTWAREASN D:1133 , ASP D:1146BINDING SITE FOR RESIDUE MG D 13
08AC8SOFTWAREASP D:1146BINDING SITE FOR RESIDUE MG D 14
09AC9SOFTWAREASN E:1133 , ASP E:1146BINDING SITE FOR RESIDUE MG E 15
10BC1SOFTWAREASP E:1146BINDING SITE FOR RESIDUE MG E 16
11BC2SOFTWAREASN F:1133 , ASP F:1146BINDING SITE FOR RESIDUE MG F 17
12BC3SOFTWAREASP F:1146BINDING SITE FOR RESIDUE MG F 18
13BC4SOFTWAREPRO B:1098 , GLU B:1199BINDING SITE FOR RESIDUE MG B 19
14BC5SOFTWAREPRO A:1098 , GLU A:1199BINDING SITE FOR RESIDUE MG A 20
15BC6SOFTWAREPRO C:1098 , GLU C:1199BINDING SITE FOR RESIDUE MG C 21
16BC7SOFTWAREGLY B:1006 , GLY B:1008 , ALA B:1009 , GLU C:1207BINDING SITE FOR RESIDUE MG C 22
17BC8SOFTWAREGLY D:1006 , GLY D:1008 , GLU F:1207BINDING SITE FOR RESIDUE MG D 23
18BC9SOFTWAREGLY A:1006 , GLU B:1207BINDING SITE FOR RESIDUE MG B 24
19CC1SOFTWAREGLU A:1207 , GLY C:1006 , GLY C:1008BINDING SITE FOR RESIDUE MG A 25
20CC2SOFTWARELEU A:1005 , GLY A:1006 , LYS A:1028 , ILE A:1065 , GLU A:1082 , HIS A:1084 , GLY A:1087 , ASP A:1089 , GLU A:1132 , ASN A:1133 , ILE A:1145 , ASP A:1146BINDING SITE FOR RESIDUE ADP A 1
21CC3SOFTWAREGLY B:1006 , LYS B:1028 , ILE B:1065 , GLU B:1082 , HIS B:1084 , GLY B:1087 , ASP B:1089 , GLU B:1132 , ASN B:1133 , ASP B:1146BINDING SITE FOR RESIDUE ADP B 2
22CC4SOFTWARELEU C:1005 , GLY C:1006 , LYS C:1028 , ILE C:1065 , MET C:1081 , GLU C:1082 , HIS C:1084 , GLY C:1087 , ASP C:1089 , GLU C:1132 , ASN C:1133 , ILE C:1145 , ASP C:1146BINDING SITE FOR RESIDUE ADP C 3
23CC5SOFTWARELYS D:1028 , ILE D:1065 , GLU D:1082 , HIS D:1084 , GLY D:1087 , ASP D:1089 , GLU D:1132 , ASN D:1133 , ILE D:1145 , ASP D:1146BINDING SITE FOR RESIDUE ADP D 4
24CC6SOFTWARELEU E:1005 , GLY E:1006 , LYS E:1028 , ILE E:1065 , GLU E:1082 , HIS E:1084 , GLY E:1087 , ASP E:1089 , GLU E:1132 , ASN E:1133 , ILE E:1145 , ASP E:1146BINDING SITE FOR RESIDUE ADP E 5
25CC7SOFTWAREGLY F:1006 , LYS F:1028 , ILE F:1065 , GLU F:1082 , HIS F:1084 , GLY F:1087 , ASP F:1089 , GLU F:1132 , ASN F:1133 , ILE F:1145 , ASP F:1146BINDING SITE FOR RESIDUE ADP F 6

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3DLS)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3DLS)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 12)

Asymmetric Unit (2, 12)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_028297V1210MPASK_HUMANPolymorphism10167000A/B/C/D/E/FV1210M
2UniProtVAR_028298F1266CPASK_HUMANPolymorphism1131293A/B/C/D/E/FF1266C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_028297V1210MPASK_HUMANPolymorphism10167000AV1210M
2UniProtVAR_028298F1266CPASK_HUMANPolymorphism1131293AF1266C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_028297V1210MPASK_HUMANPolymorphism10167000BV1210M
2UniProtVAR_028298F1266CPASK_HUMANPolymorphism1131293BF1266C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_028297V1210MPASK_HUMANPolymorphism10167000CV1210M
2UniProtVAR_028298F1266CPASK_HUMANPolymorphism1131293CF1266C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_028297V1210MPASK_HUMANPolymorphism10167000DV1210M
2UniProtVAR_028298F1266CPASK_HUMANPolymorphism1131293DF1266C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 5 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_028297V1210MPASK_HUMANPolymorphism10167000EV1210M
2UniProtVAR_028298F1266CPASK_HUMANPolymorphism1131293EF1266C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 6 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_028297V1210MPASK_HUMANPolymorphism10167000FV1210M
2UniProtVAR_028298F1266CPASK_HUMANPolymorphism1131293FF1266C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 7 (2, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_028297V1210MPASK_HUMANPolymorphism10167000A/B/CV1210M
2UniProtVAR_028298F1266CPASK_HUMANPolymorphism1131293A/B/CF1266C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 8 (2, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_028297V1210MPASK_HUMANPolymorphism10167000D/E/FV1210M
2UniProtVAR_028298F1266CPASK_HUMANPolymorphism1131293D/E/FF1266C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 12)

Asymmetric Unit (2, 12)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.PASK_HUMAN1005-1032
 
 
 
 
 
  6A:1005-1032
B:1005-1032
C:1005-1032
D:1005-1032
E:1005-1032
F:1005-1032
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.PASK_HUMAN1124-1136
 
 
 
 
 
  6A:1124-1136
B:1124-1136
C:1124-1136
D:1124-1136
E:1124-1136
F:1124-1136
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.PASK_HUMAN1005-1032
 
 
 
 
 
  1A:1005-1032
-
-
-
-
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.PASK_HUMAN1124-1136
 
 
 
 
 
  1A:1124-1136
-
-
-
-
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.PASK_HUMAN1005-1032
 
 
 
 
 
  1-
B:1005-1032
-
-
-
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.PASK_HUMAN1124-1136
 
 
 
 
 
  1-
B:1124-1136
-
-
-
-
Biological Unit 3 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.PASK_HUMAN1005-1032
 
 
 
 
 
  1-
-
C:1005-1032
-
-
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.PASK_HUMAN1124-1136
 
 
 
 
 
  1-
-
C:1124-1136
-
-
-
Biological Unit 4 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.PASK_HUMAN1005-1032
 
 
 
 
 
  1-
-
-
D:1005-1032
-
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.PASK_HUMAN1124-1136
 
 
 
 
 
  1-
-
-
D:1124-1136
-
-
Biological Unit 5 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.PASK_HUMAN1005-1032
 
 
 
 
 
  1-
-
-
-
E:1005-1032
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.PASK_HUMAN1124-1136
 
 
 
 
 
  1-
-
-
-
E:1124-1136
-
Biological Unit 6 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.PASK_HUMAN1005-1032
 
 
 
 
 
  1-
-
-
-
-
F:1005-1032
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.PASK_HUMAN1124-1136
 
 
 
 
 
  1-
-
-
-
-
F:1124-1136
Biological Unit 7 (2, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.PASK_HUMAN1005-1032
 
 
 
 
 
  3A:1005-1032
B:1005-1032
C:1005-1032
-
-
-
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.PASK_HUMAN1124-1136
 
 
 
 
 
  3A:1124-1136
B:1124-1136
C:1124-1136
-
-
-
Biological Unit 8 (2, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.PASK_HUMAN1005-1032
 
 
 
 
 
  3-
-
-
D:1005-1032
E:1005-1032
F:1005-1032
2PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.PASK_HUMAN1124-1136
 
 
 
 
 
  3-
-
-
D:1124-1136
E:1124-1136
F:1124-1136

(-) Exons   (6, 36)

Asymmetric Unit (6, 36)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2aENST000002340402aENSE00001951272chr2:242088919-24208882991PASK_HUMAN-00--
1.4ENST000002340404ENSE00001038616chr2:242082489-242082252238PASK_HUMAN1-66660--
1.5cENST000002340405cENSE00000827792chr2:242080168-242079936233PASK_HUMAN66-143780--
1.6ENST000002340406ENSE00000827791chr2:242079470-242079300171PASK_HUMAN144-200570--
1.8bENST000002340408bENSE00001801483chr2:242078209-242078069141PASK_HUMAN201-247470--
1.9ENST000002340409ENSE00001676196chr2:242077502-242077368135PASK_HUMAN248-292450--
1.10cENST0000023404010cENSE00001684990chr2:242076679-242076419261PASK_HUMAN293-379870--
1.11bENST0000023404011bENSE00000827787chr2:242075454-242075286169PASK_HUMAN380-436570--
1.12bENST0000023404012bENSE00000827785chr2:242072445-242072289157PASK_HUMAN436-488530--
1.14bENST0000023404014bENSE00000787329chr2:242066866-2420656111256PASK_HUMAN488-9074200--
1.15ENST0000023404015ENSE00000827783chr2:242063548-242063364185PASK_HUMAN907-968620--
1.16ENST0000023404016ENSE00000787331chr2:242062314-242062147168PASK_HUMAN969-1024566A:982-1024
B:982-1024
C:982-1024
D:982-1024
E:982-1024
F:982-1024
43
43
43
43
43
43
1.17ENST0000023404017ENSE00000827781chr2:242054828-242054703126PASK_HUMAN1025-1066426A:1025-1066
B:1025-1066 (gaps)
C:1025-1066 (gaps)
D:1025-1066 (gaps)
E:1025-1066 (gaps)
F:1025-1066 (gaps)
42
42
42
42
42
42
1.18aENST0000023404018aENSE00000827780chr2:242054592-242054458135PASK_HUMAN1067-1111456A:1067-1111
B:1067-1111
C:1067-1111
D:1067-1111
E:1067-1111
F:1067-1111
45
45
45
45
45
45
1.19bENST0000023404019bENSE00000827778chr2:242051854-242051655200PASK_HUMAN1112-1178676A:1112-1178
B:1112-1178
C:1112-1178
D:1112-1178
E:1112-1178
F:1112-1178
67
67
67
67
67
67
1.21ENST0000023404021ENSE00000827777chr2:242047715-242047582134PASK_HUMAN1178-1223466A:1178-1223
B:1178-1223
C:1178-1223
D:1178-1223
E:1178-1223
F:1178-1223
46
46
46
46
46
46
1.22cENST0000023404022cENSE00000827776chr2:242046914-242046768147PASK_HUMAN1223-1272506A:1223-1266
B:1223-1267
C:1223-1267
D:1223-1266
E:1223-1267
F:1223-1266
44
45
45
44
45
44
1.23cENST0000023404023cENSE00001038619chr2:242046138-242045514625PASK_HUMAN1272-1323520--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:285
 aligned with PASK_HUMAN | Q96RG2 from UniProtKB/Swiss-Prot  Length:1323

    Alignment length:285
                                   991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261     
          PASK_HUMAN    982 AVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVF 1266
               SCOP domains d3dlsa_ A: automated matches                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee.hhhhhhhhhhhhheeeeee........eeeeee....eeeeeeeee........eeee...eeeehhhhhhh.........eeeeee...eeeeeee......hhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee........ee..hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh.....hhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhh.......hhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M-------------------------------------------------------C SAPs(SNPs)
                    PROSITE -----------------------PROTEIN_KINASE_ATP          -------------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.16  PDB: A:982-1024 [INCOMPLETE]    Exon 1.17  PDB: A:1025-1066               Exon 1.18a  PDB: A:1067-1111                 Exon 1.19b  PDB: A:1112-1178 UniProt: 1112-1178                    --------------------------------------------Exon 1.22c  PDB: A:1223-1266 [INCOMPLETE]    Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.21  PDB: A:1178-1223 UniProt: 1178-1223------------------------------------------- Transcript 1 (2)
                3dls A  982 AVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVF 1266
                                   991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261     

Chain B from PDB  Type:PROTEIN  Length:280
 aligned with PASK_HUMAN | Q96RG2 from UniProtKB/Swiss-Prot  Length:1323

    Alignment length:286
                                   991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      
          PASK_HUMAN    982 AVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFR 1267
               SCOP domains d3dlsb_ B: automated matches                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee.hhhhhhhhhhhhheeeeee........eeeeee....eeeeeeeee..------.eee...eeehhhhhhhhhh.......eeeeee...eeeeeee......hhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.ee........eee.....eee......ee........ee..hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh......hhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhh.......hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M-------------------------------------------------------C- SAPs(SNPs)
                    PROSITE -----------------------PROTEIN_KINASE_ATP          -------------------------------------------------------------------------------------------PROTEIN_KINAS----------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.16  PDB: B:982-1024 [INCOMPLETE]    Exon 1.17  PDB: B:1025-1066 (gaps)        Exon 1.18a  PDB: B:1067-1111                 Exon 1.19b  PDB: B:1112-1178 UniProt: 1112-1178                    --------------------------------------------Exon 1.22c  PDB: B:1223-1267 [INCOMPLETE]     Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.21  PDB: B:1178-1223 UniProt: 1178-1223-------------------------------------------- Transcript 1 (2)
                3dls B  982 AVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKE------WIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFR 1267
                                   991      1001      1011      1021      1031 |    1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      
                                                                            1033   1040                                                                                                                                                                                                                                   

Chain C from PDB  Type:PROTEIN  Length:281
 aligned with PASK_HUMAN | Q96RG2 from UniProtKB/Swiss-Prot  Length:1323

    Alignment length:286
                                   991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      
          PASK_HUMAN    982 AVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFR 1267
               SCOP domains d3dlsc_ C: automated matches                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee.hhhhhhhhhhhhheeeeee........eeeeee....eeeeeeeee....-----.........hhhhhhhhhh.......eeeeee...eeeeeee......hhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee........ee..hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh.....................hhhhhhhhhhhh........hhhhhhhhhhhhh..hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M-------------------------------------------------------C- SAPs(SNPs)
                    PROSITE -----------------------PROTEIN_KINASE_ATP          -------------------------------------------------------------------------------------------PROTEIN_KINAS----------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.16  PDB: C:982-1024 [INCOMPLETE]    Exon 1.17  PDB: C:1025-1066 (gaps)        Exon 1.18a  PDB: C:1067-1111                 Exon 1.19b  PDB: C:1112-1178 UniProt: 1112-1178                    --------------------------------------------Exon 1.22c  PDB: C:1223-1267 [INCOMPLETE]     Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.21  PDB: C:1178-1223 UniProt: 1178-1223-------------------------------------------- Transcript 1 (2)
                3dls C  982 AVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKV-----IEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFR 1267
                                   991      1001      1011      1021      1031   |  1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      
                                                                              1035  1041                                                                                                                                                                                                                                  

Chain D from PDB  Type:PROTEIN  Length:284
 aligned with PASK_HUMAN | Q96RG2 from UniProtKB/Swiss-Prot  Length:1323

    Alignment length:285
                                   991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261     
          PASK_HUMAN    982 AVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVF 1266
               SCOP domains d3dlsd_ D: automated matches                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhheeeeee........eeeeee....eeeeeeeee.hhh.-..eeee...eeeehhhhhhhh........eeeeee...eeeeeee......hhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee............hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh.....hhhhhh..........hhhhhhhhhhhh........hhhhhhhhhhhhh..hhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M-------------------------------------------------------C SAPs(SNPs)
                    PROSITE -----------------------PROTEIN_KINASE_ATP          -------------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.16  PDB: D:982-1024 [INCOMPLETE]    Exon 1.17  PDB: D:1025-1066 (gaps)        Exon 1.18a  PDB: D:1067-1111                 Exon 1.19b  PDB: D:1112-1178 UniProt: 1112-1178                    --------------------------------------------Exon 1.22c  PDB: D:1223-1266 [INCOMPLETE]    Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.21  PDB: D:1178-1223 UniProt: 1178-1223------------------------------------------- Transcript 1 (2)
                3dls D  982 AVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVL-DCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVF 1266
                                   991      1001      1011      1021      1031    | 1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261     
                                                                               1036 |                                                                                                                                                                                                                                    
                                                                                 1038                                                                                                                                                                                                                                    

Chain E from PDB  Type:PROTEIN  Length:282
 aligned with PASK_HUMAN | Q96RG2 from UniProtKB/Swiss-Prot  Length:1323

    Alignment length:286
                                   991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      
          PASK_HUMAN    982 AVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFR 1267
               SCOP domains d3dlse_ E: automated matches                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhh.hhhhhheeeeee........eeeeee.....eeeeeeee.hhh----.eee...eeehhhhhhhhhh.......eeeeee...eeeeeee......hhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee............hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh.....hhhhhhh.........hhhhhhhhhhhh........hhhhhhhhhhhhh..hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M-------------------------------------------------------C- SAPs(SNPs)
                    PROSITE -----------------------PROTEIN_KINASE_ATP          -------------------------------------------------------------------------------------------PROTEIN_KINAS----------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.16  PDB: E:982-1024 [INCOMPLETE]    Exon 1.17  PDB: E:1025-1066 (gaps)        Exon 1.18a  PDB: E:1067-1111                 Exon 1.19b  PDB: E:1112-1178 UniProt: 1112-1178                    --------------------------------------------Exon 1.22c  PDB: E:1223-1267 [INCOMPLETE]     Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.21  PDB: E:1178-1223 UniProt: 1178-1223-------------------------------------------- Transcript 1 (2)
                3dls E  982 AVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKV----WIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFR 1267
                                   991      1001      1011      1021      1031   |  1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261      
                                                                              1035 1040                                                                                                                                                                                                                                   

Chain F from PDB  Type:PROTEIN  Length:281
 aligned with PASK_HUMAN | Q96RG2 from UniProtKB/Swiss-Prot  Length:1323

    Alignment length:285
                                   991      1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261     
          PASK_HUMAN    982 AVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVF 1266
               SCOP domains d3dlsf_ F: automated matches                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhh.hhhhheeeeee........eeeeee.....eeeeeeee....----.eee...eeehhhhhhhhhh.......eeeeee...eeeeeee......hhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee............hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh.....hhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhh........hhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M-------------------------------------------------------C SAPs(SNPs)
                    PROSITE -----------------------PROTEIN_KINASE_ATP          -------------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.16  PDB: F:982-1024 [INCOMPLETE]    Exon 1.17  PDB: F:1025-1066 (gaps)        Exon 1.18a  PDB: F:1067-1111                 Exon 1.19b  PDB: F:1112-1178 UniProt: 1112-1178                    --------------------------------------------Exon 1.22c  PDB: F:1223-1266 [INCOMPLETE]    Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.21  PDB: F:1178-1223 UniProt: 1178-1223------------------------------------------- Transcript 1 (2)
                3dls F  982 AVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKV----WIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVF 1266
                                   991      1001      1011      1021      1031   |  1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221      1231      1241      1251      1261     
                                                                              1035 1040                                                                                                                                                                                                                                  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 6)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3DLS)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3DLS)

(-) Gene Ontology  (20, 20)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F   (PASK_HUMAN | Q96RG2)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0035091    phosphatidylinositol binding    Interacting selectively and non-covalently with any inositol-containing glycerophospholipid, i.e. phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0045719    negative regulation of glycogen biosynthetic process    Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of glycogen.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0045727    positive regulation of translation    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
    GO:0046777    protein autophosphorylation    The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:2000505    regulation of energy homeostasis    Any process that modulates the frequency, rate or extent of energy homeostasis.
    GO:0070092    regulation of glucagon secretion    Any process that modulates the frequency, rate or extent of the regulated release of glucagon.
    GO:0043576    regulation of respiratory gaseous exchange    Any process that modulates the frequency, rate or extent of the process of gaseous exchange between an organism and its environment.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ADP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3dls)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]
    Biological Unit 7  [ Jena3D ]
    Biological Unit 8  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3dls
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PASK_HUMAN | Q96RG2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PASK_HUMAN | Q96RG2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PASK_HUMAN | Q96RG21ll8

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3DLS)