Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  X-RAY STRUCTURE OF HUMAN GLUTAMATE CARBOXYPEPTIDASE II (GCPII) IN COMPLEX WITH A TRANSITION STATE ANALOG OF ASP-GLU
 
Authors :  J. Lubkowski, C. Barinka
Date :  29 Nov 07  (Deposition) - 08 Jan 08  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Prostate Specific Membrane Antigen, Metallopeptidase, Folate Hydrolase, Glutamate Carboxypeptidase Ii, Naaladase, Dipeptidase, Glycoprotein, Metal-Binding, Metalloprotease, Multifunctional Enzyme, Protease, Signal-Anchor, Transmembrane, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Barinka, K. Hlouchova, M. Rovenska, P. Majer, M. Dauter, N. Hin, Y. S. Ko, T. Tsukamoto, B. S. Slusher, J. Konvalinka, J. Lubkowski
Structural Basis Of Interactions Between Human Glutamate Carboxypeptidase Ii And Its Substrate Analogs
J. Mol. Biol. V. 376 1438 2008
PubMed-ID: 18234225  |  Reference-DOI: 10.1016/J.JMB.2007.12.066

(-) Compounds

Molecule 1 - GLUTAMATE CARBOXYPEPTIDASE 2
    ChainsA
    EC Number3.4.17.21
    EngineeredYES
    Expression SystemDROSOPHILA MELANOGASTER
    Expression System CommonFRUIT FLY
    Expression System StrainSCHNEIDER'S S2 CELLS
    Expression System Taxid7227
    Expression System Vector TypePLASMID
    FragmentEXTRACELLULAR DOMAIN RESIDUES 44-750
    GeneFOLH1, FOLH, NAALAD1, PSM, PSMA
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymGLUTAMATE CARBOXYPEPTIDASE II, MEMBRANE GLUTAMATE CARBOXYPEPTIDASE, MGCP, N- ACETYLATED-ALPHA-LINKED ACIDIC DIPEPTIDASE I, NAALADASE I, PTEROYLPOLY-GAMMA-GLUTAMATE CARBOXYPEPTIDASE, FOLYLPOLY-GAMMA- GLUTAMATE CARBOXYPEPTIDASE, FGCP, FOLATE HYDROLASE 1, PROSTATE- SPECIFIC MEMBRANE ANTIGEN, PSMA, PSM

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (7, 18)

Asymmetric Unit (7, 18)
No.NameCountTypeFull Name
1BHX1Ligand/Ion(2S)-2-{[(S)-(2-CARBOXYETHYL)(HYDROXY)PHOSPHORYL]METHYL}PENTANEDIOIC ACID
2BMA1Ligand/IonBETA-D-MANNOSE
3CA1Ligand/IonCALCIUM ION
4CL1Ligand/IonCHLORIDE ION
5MAN1Ligand/IonALPHA-D-MANNOSE
6NAG11Ligand/IonN-ACETYL-D-GLUCOSAMINE
7ZN2Ligand/IonZINC ION
Biological Unit 1 (4, 28)
No.NameCountTypeFull Name
1BHX2Ligand/Ion(2S)-2-{[(S)-(2-CARBOXYETHYL)(HYDROXY)PHOSPHORYL]METHYL}PENTANEDIOIC ACID
2BMA2Ligand/IonBETA-D-MANNOSE
3CA-1Ligand/IonCALCIUM ION
4CL-1Ligand/IonCHLORIDE ION
5MAN2Ligand/IonALPHA-D-MANNOSE
6NAG22Ligand/IonN-ACETYL-D-GLUCOSAMINE
7ZN-1Ligand/IonZINC ION

(-) Sites  (18, 18)

Asymmetric Unit (18, 18)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASN A:76 , GLN A:99 , NAG A:1756 , HOH A:2016 , HOH A:2057 , HOH A:2323BINDING SITE FOR RESIDUE NAG A 1755
02AC2SOFTWARENAG A:1755 , HOH A:2026 , HOH A:2323 , HOH A:2374BINDING SITE FOR RESIDUE NAG A 1756
03AC3SOFTWAREASN A:121 , THR A:123 , HIS A:124 , THR A:349 , HOH A:2094BINDING SITE FOR RESIDUE NAG A 1757
04AC4SOFTWARETYR A:127 , GLU A:137 , ILE A:138 , ASN A:140 , NAG A:1767 , HOH A:2269BINDING SITE FOR RESIDUE NAG A 1758
05AC5SOFTWARENAG A:1758 , HOH A:2178 , HOH A:2367BINDING SITE FOR RESIDUE NAG A 1767
06AC6SOFTWAREASN A:195 , SER A:197 , HOH A:2414BINDING SITE FOR RESIDUE NAG A 1759
07AC7SOFTWARETRP A:246 , ASN A:459 , PHE A:565 , TYR A:566 , HOH A:1845 , HOH A:2044 , HOH A:2095 , HOH A:2162BINDING SITE FOR RESIDUE NAG A 1760
08AC8SOFTWARESER A:472 , ASN A:476 , PRO A:594 , NAG A:1762 , HOH A:2053 , HOH A:2102 , HOH A:2306BINDING SITE FOR RESIDUE NAG A 1761
09AC9SOFTWARENAG A:1761 , HOH A:1986 , HOH A:2384 , HOH A:2432BINDING SITE FOR RESIDUE NAG A 1762
10BC1SOFTWARESER A:631 , SER A:634 , ASN A:638 , GLN A:740 , NAG A:1764 , HOH A:1894 , HOH A:1928 , HOH A:2133BINDING SITE FOR RESIDUE NAG A 1763
11BC2SOFTWARENAG A:1763 , BMA A:1765 , HOH A:2061 , HOH A:2168BINDING SITE FOR RESIDUE NAG A 1764
12BC3SOFTWAREHIS A:112 , GLU A:276 , LYS A:324 , ARG A:354 , NAG A:1764 , MAN A:1766 , HOH A:2375 , HOH A:2376BINDING SITE FOR RESIDUE BMA A 1765
13BC4SOFTWAREPHE A:235 , LYS A:240 , SER A:241 , GLU A:276 , BMA A:1765 , HOH A:1959 , HOH A:2131 , HOH A:2134 , HOH A:2362BINDING SITE FOR RESIDUE MAN A 1766
14BC5SOFTWAREBHX A:1 , ASP A:387 , GLU A:425 , HIS A:553 , ZN A:1752BINDING SITE FOR RESIDUE ZN A 1751
15BC6SOFTWAREBHX A:1 , HIS A:377 , ASP A:387 , GLU A:424 , ASP A:453 , ZN A:1751BINDING SITE FOR RESIDUE ZN A 1752
16BC7SOFTWARETHR A:269 , TYR A:272 , GLU A:433 , GLU A:436 , HOH A:1773BINDING SITE FOR RESIDUE CA A 1753
17BC8SOFTWAREASN A:451 , ASP A:453 , ARG A:534 , ARG A:536BINDING SITE FOR RESIDUE CL A 1754
18BC9SOFTWAREARG A:210 , ASN A:257 , HIS A:377 , ASP A:387 , GLU A:424 , GLU A:425 , GLY A:427 , ASP A:453 , GLY A:518 , ASN A:519 , ARG A:534 , TYR A:552 , HIS A:553 , LYS A:699 , TYR A:700 , ZN A:1751 , ZN A:1752 , HOH A:1776 , HOH A:1939 , HOH A:1943 , HOH A:2371 , HOH A:2394BINDING SITE FOR RESIDUE BHX A 1

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3BHX)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric Unit
No.Residues
1Tyr A:242 -Pro A:243
2Gly A:330 -Pro A:331
3Asp A:387 -Pro A:388

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (3, 3)

Asymmetric Unit (3, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_024592Y75HFOLH1_HUMANPolymorphism202676AY75H
2UniProtVAR_012736H475YFOLH1_HUMANPolymorphism61886492AH475Y
3UniProtVAR_028882V627LFOLH1_HUMANPolymorphism2988342AV627L

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (3, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_024592Y75HFOLH1_HUMANPolymorphism202676AY75H
2UniProtVAR_012736H475YFOLH1_HUMANPolymorphism61886492AH475Y
3UniProtVAR_028882V627LFOLH1_HUMANPolymorphism2988342AV627L

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3BHX)

(-) Exons   (18, 18)

Asymmetric Unit (18, 18)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002569991aENSE00001364015chr11:49230222-49229844379FOLH1_HUMAN1-40400--
1.5ENST000002569995ENSE00001771797chr11:49227724-49227619106FOLH1_HUMAN40-75361A:55-7521
1.6cENST000002569996cENSE00001804269chr11:49221993-49221807187FOLH1_HUMAN75-137631A:75-13763
1.7aENST000002569997aENSE00001603272chr11:49214446-49214345102FOLH1_HUMAN138-171341A:138-17134
1.8aENST000002569998aENSE00001701397chr11:49208321-49208196126FOLH1_HUMAN172-213421A:172-21342
1.9bENST000002569999bENSE00001627795chr11:49207407-49207221187FOLH1_HUMAN214-276631A:214-27663
1.10ENST0000025699910ENSE00001652660chr11:49204794-4920470194FOLH1_HUMAN276-307321A:276-30732
1.11bENST0000025699911bENSE00001780619chr11:49197509-4919741199FOLH1_HUMAN307-340341A:307-34034
1.12aENST0000025699912aENSE00001612233chr11:49196529-4919644486FOLH1_HUMAN340-369301A:340-36930
1.13ENST0000025699913ENSE00001643735chr11:49195028-49194909120FOLH1_HUMAN369-409411A:369-40941
1.14ENST0000025699914ENSE00001765179chr11:49192829-4919274783FOLH1_HUMAN409-436281A:409-43628
1.15ENST0000025699915ENSE00001800342chr11:49190810-4919074764FOLH1_HUMAN437-458221A:437-45822
1.16ENST0000025699916ENSE00001739662chr11:49186324-4918625768FOLH1_HUMAN458-480231A:458-48023
1.18ENST0000025699918ENSE00001704015chr11:49179595-4917950492FOLH1_HUMAN481-511311A:481-51131
1.19aENST0000025699919aENSE00001639568chr11:49178359-4917826991FOLH1_HUMAN511-541311A:511-54131
1.20aENST0000025699920aENSE00001804599chr11:49176044-49175780265FOLH1_HUMAN542-630891A:542-63089
1.21bENST0000025699921bENSE00001637755chr11:49175479-4917539882FOLH1_HUMAN630-657281A:630-657 (gaps)28
1.22ENST0000025699922ENSE00001748529chr11:49170283-4917019193FOLH1_HUMAN657-688321A:657-68832
1.23dENST0000025699923dENSE00002199992chr11:49168497-49168187311FOLH1_HUMAN688-750631A:688-75063

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:694
 aligned with FOLH1_HUMAN | Q04609 from UniProtKB/Swiss-Prot  Length:750

    Alignment length:696
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634       644       654       664       674       684       694       704       714       724       734       744      
          FOLH1_HUMAN    55 KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA 750
               SCOP domains --d3bhxa3 A:57-117,A:351-593                                   d3bhxa2 A:118-350 Glutamate carboxypeptidase II                                                                                                                                                                                          d3bhxa3 A:57-117,A:351-593 Glutamate carboxypeptidase II FOLH1                                                                                                                                                                                     d3bhxa1 A:594-750 Glutamate carboxypeptidase II                                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhh..eeeeeeeeeeeee.......eeeee.....eeee.....................ee.......ee.eee....hhhhhhhhhhh........eeeee....hhhhhhhhhhhh...eeeee.hhhhhh....................ee........................hhhhh.......eeeehhhhhhhhhh........hhhhh.............hhhhh..eeeee...eeeeeeeeeeeeee....eeeeeeeeeee..........hhhhhhhhhhhhhhhhhhhhh.....eeeeeeee.hhhhhhhhhhhhhhhhhhhhhhheeeeee.........eeeeee...hhhhhhhhhhh...........hhhhhhhhhh..........ee.......hhhhhhh...eeeeeeee..hhhhh............hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh.hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh--.hhhhhhhhhhhhhhhhhh.................eeee..eeeeeeehhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------H---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Y-------------------------------------------------------------------------------------------------------------------------------------------------------L--------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.5  PDB: A:55-7--------------------------------------------------------------Exon 1.7a  PDB: A:138-171         Exon 1.8a  PDB: A:172-213 UniProt: 172-213--------------------------------------------------------------Exon 1.10  PDB: A:276-307       --------------------------------Exon 1.12a  PDB: A:340-369    ---------------------------------------Exon 1.14  PDB: A:409-436   Exon 1.15             ----------------------Exon 1.18  PDB: A:481-511      ------------------------------Exon 1.20a  PDB: A:542-630 UniProt: 542-630                                              --------------------------Exon 1.22  PDB: A:657-688       -------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------Exon 1.6c  PDB: A:75-137 UniProt: 75-137                       ----------------------------------------------------------------------------Exon 1.9b  PDB: A:214-276 UniProt: 214-276                     ------------------------------Exon 1.11b  PDB: A:307-340        ----------------------------Exon 1.13  PDB: A:369-409                ------------------------------------------------Exon 1.16              ------------------------------Exon 1.19a  PDB: A:511-541     ----------------------------------------------------------------------------------------Exon 1.21b UniProt: 630-657 ------------------------------Exon 1.23d  PDB: A:688-750 UniProt: 688-750                     Transcript 1 (2)
                 3bhx A  55 KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDF--SNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA 750
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634       644        |- |     664       674       684       694       704       714       724       734       744      
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                653  |                                                                                              
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   656                                                                                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 3)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3BHX)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3BHX)

(-) Gene Ontology  (22, 22)

Asymmetric Unit(hide GO term definitions)
Chain A   (FOLH1_HUMAN | Q04609)
molecular function
    GO:1904492    Ac-Asp-Glu binding    Interacting selectively and non-covalently with Ac-Asp-Glu.
    GO:0004180    carboxypeptidase activity    Catalysis of the hydrolysis of the terminal or penultimate peptide bond at the C-terminal end of a peptide or polypeptide.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016805    dipeptidase activity    Catalysis of the hydrolysis of a dipeptide.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004181    metallocarboxypeptidase activity    Catalysis of the hydrolysis of C-terminal amino acid residues from a polypeptide chain by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.
    GO:0008237    metallopeptidase activity    Catalysis of the hydrolysis of peptide bonds by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:1904493    tetrahydrofolyl-poly(glutamate) polymer binding    Interacting selectively and non-covalently with tetrahydrofolyl-poly(glutamate) polymer.
biological process
    GO:0035609    C-terminal protein deglutamylation    The removal of a C-terminal, gene-encoded glutamate residue from a protein.
    GO:0008652    cellular amino acid biosynthetic process    The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.
    GO:0006760    folic acid-containing compound metabolic process    The chemical reactions and pathways involving a folic acid-containing compound, i.e. any of a group of heterocyclic compounds based on the pteroic acid skeleton conjugated with one or more L-glutamic acid or L-glutamate units.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BHX  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asp A:387 - Pro A:388   [ RasMol ]  
    Gly A:330 - Pro A:331   [ RasMol ]  
    Tyr A:242 - Pro A:243   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3bhx
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FOLH1_HUMAN | Q04609
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.17.21
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FOLH1_HUMAN | Q04609
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FOLH1_HUMAN | Q046091z8l 2c6c 2c6g 2c6p 2cij 2jbj 2jbk 2oot 2or4 2pvv 2pvw 2xef 2xeg 2xei 2xej 3bi0 3bi1 3bxm 3d7d 3d7f 3d7g 3d7h 3iww 3rbu 3sje 3sjf 3sjg 3sjx 4jyw 4jz0 4lqg 4mcp 4mcq 4mcr 4mcs 4ngm 4ngn 4ngp 4ngq 4ngr 4ngs 4ngt 4oc0 4oc1 4oc2 4oc3 4oc4 4oc5 4ome 4p44 4p45 4p4b 4p4d 4p4e 4p4f 4p4i 4p4j 4w9y 4x3r 5d29 5ely 5f09

(-) Related Entries Specified in the PDB File

3bi0 3bi1