Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
(-)Biological Unit 7
(-)Biological Unit 8
(-)Biological Unit 9
(-)Biological Unit 10
(-)Biological Unit 11
(-)Biological Unit 12
(-)Biological Unit 13
(-)Biological Unit 14
(-)Biological Unit 15
(-)Biological Unit 16
(-)Biological Unit 17
(-)Biological Unit 18
(-)Biological Unit 19
(-)Biological Unit 20
(-)Biological Unit 21
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)
Image Biological Unit 7
Biological Unit 7  (Jmol Viewer)
Image Biological Unit 8
Biological Unit 8  (Jmol Viewer)
Image Biological Unit 9
Biological Unit 9  (Jmol Viewer)
Image Biological Unit 10
Biological Unit 10  (Jmol Viewer)
Image Biological Unit 11
Biological Unit 11  (Jmol Viewer)
Image Biological Unit 12
Biological Unit 12  (Jmol Viewer)
Image Biological Unit 13
Biological Unit 13  (Jmol Viewer)
Image Biological Unit 14
Biological Unit 14  (Jmol Viewer)
Image Biological Unit 15
Biological Unit 15  (Jmol Viewer)
Image Biological Unit 16
Biological Unit 16  (Jmol Viewer)
Image Biological Unit 17
Biological Unit 17  (Jmol Viewer)
Image Biological Unit 18
Biological Unit 18  (Jmol Viewer)
Image Biological Unit 19
Biological Unit 19  (Jmol Viewer)
Image Biological Unit 20
Biological Unit 20  (Jmol Viewer)
Image Biological Unit 21
Biological Unit 21  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF URACIL-DNA GLYCOSYLASE FROM MYCOBACTERIUM TUBERCULOSIS IN COMPLEX WITH A PROTEINACEOUS INHIBITOR
 
Authors :  P. S. Kaushal, R. K. Talawar, P. D. V. Krishna, U. Varshney, M. Vijayan
Date :  11 Feb 08  (Deposition) - 20 May 08  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.10
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Biol. Unit 5:  E  (1x)
Biol. Unit 6:  F  (1x)
Biol. Unit 7:  G  (1x)
Biol. Unit 8:  H  (1x)
Biol. Unit 9:  I  (1x)
Biol. Unit 10:  J  (1x)
Biol. Unit 11:  K  (1x)
Biol. Unit 12:  L  (1x)
Biol. Unit 13:  M  (1x)
Biol. Unit 14:  N  (1x)
Biol. Unit 15:  A,B  (1x)
Biol. Unit 16:  C,D  (1x)
Biol. Unit 17:  E,F  (1x)
Biol. Unit 18:  G,H  (1x)
Biol. Unit 19:  I,J  (1x)
Biol. Unit 20:  K,L  (1x)
Biol. Unit 21:  M,N  (1x)
Keywords :  Dna Repair, Ung-Ugi Complex, Ung-Dna Interactions, Dna Damage, Glycosidase, Hydrolase, Hydrolase-Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  P. S. Kaushal, R. K. Talawar, P. D. V. Krishna, U. Varshney, M. Vijayan
Unique Features Of The Structure And Interactions Of Mycobacterial Uracil-Dna Glycosylase: Structure Of A Comple Of The Mycobacterium Tuberculosis Enzyme In Comparison With Those From Other Sources
Acta Crystallogr. , Sect. D V. 64 551 2008
PubMed-ID: 18453691  |  Reference-DOI: 10.1107/S090744490800512X
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - URACIL-DNA GLYCOSYLASE
    ChainsA, C, E, G, I, K, M
    EC Number3.2.2.3
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPRSETB MTUUDG-UGI
    Expression System StrainBL21(DE3)
    Expression System Vector TypePLASMID
    GeneUNG, RV2976C
    Organism ScientificMYCOBACTERIUM TUBERCULOSIS
    StrainH37RV
    SynonymUDG
 
Molecule 2 - URACIL-DNA GLYCOSYLASE INHIBITOR
    ChainsB, D, F, H, J, L, N
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPRSETB MTUUDG-UGI
    Expression System StrainBL21(DE3)
    Expression System Vector TypePLASMID
    GeneUGI, J04434
    Organism ScientificBACTERIOPHAGE PBS2

 Structural Features

(-) Chains, Units

  1234567891011121314
Asymmetric Unit ABCDEFGHIJKLMN
Biological Unit 1 (1x)A             
Biological Unit 2 (1x) B            
Biological Unit 3 (1x)  C           
Biological Unit 4 (1x)   D          
Biological Unit 5 (1x)    E         
Biological Unit 6 (1x)     F        
Biological Unit 7 (1x)      G       
Biological Unit 8 (1x)       H      
Biological Unit 9 (1x)        I     
Biological Unit 10 (1x)         J    
Biological Unit 11 (1x)          K   
Biological Unit 12 (1x)           L  
Biological Unit 13 (1x)            M 
Biological Unit 14 (1x)             N
Biological Unit 15 (1x)AB            
Biological Unit 16 (1x)  CD          
Biological Unit 17 (1x)    EF        
Biological Unit 18 (1x)      GH      
Biological Unit 19 (1x)        IJ    
Biological Unit 20 (1x)          KL  
Biological Unit 21 (1x)            MN

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2ZHX)

(-) Sites  (0, 0)

(no "Site" information available for 2ZHX)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2ZHX)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2ZHX)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2ZHX)

(-) PROSITE Motifs  (1, 7)

Asymmetric Unit (1, 7)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  7A:61-70
C:61-70
E:61-70
G:61-70
I:61-70
K:61-70
M:61-70
UNG_MYCTU61-70
 
 
 
 
 
 
  7A:61-70
C:61-70
E:61-70
G:61-70
I:61-70
K:61-70
M:61-70
Biological Unit 1 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  1A:61-70
-
-
-
-
-
-
UNG_MYCTU61-70
 
 
 
 
 
 
  1A:61-70
-
-
-
-
-
-
Biological Unit 2 (, 0)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  0-
-
-
-
-
-
-
UNG_MYCTU61-70
 
 
 
 
 
 
  0-
-
-
-
-
-
-
Biological Unit 3 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  1-
C:61-70
-
-
-
-
-
UNG_MYCTU61-70
 
 
 
 
 
 
  1-
C:61-70
-
-
-
-
-
Biological Unit 4 (, 0)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  0-
-
-
-
-
-
-
UNG_MYCTU61-70
 
 
 
 
 
 
  0-
-
-
-
-
-
-
Biological Unit 5 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  1-
-
E:61-70
-
-
-
-
UNG_MYCTU61-70
 
 
 
 
 
 
  1-
-
E:61-70
-
-
-
-
Biological Unit 6 (, 0)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  0-
-
-
-
-
-
-
UNG_MYCTU61-70
 
 
 
 
 
 
  0-
-
-
-
-
-
-
Biological Unit 7 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  1-
-
-
G:61-70
-
-
-
UNG_MYCTU61-70
 
 
 
 
 
 
  1-
-
-
G:61-70
-
-
-
Biological Unit 8 (, 0)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  0-
-
-
-
-
-
-
UNG_MYCTU61-70
 
 
 
 
 
 
  0-
-
-
-
-
-
-
Biological Unit 9 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  1-
-
-
-
I:61-70
-
-
UNG_MYCTU61-70
 
 
 
 
 
 
  1-
-
-
-
I:61-70
-
-
Biological Unit 10 (, 0)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  0-
-
-
-
-
-
-
UNG_MYCTU61-70
 
 
 
 
 
 
  0-
-
-
-
-
-
-
Biological Unit 11 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  1-
-
-
-
-
K:61-70
-
UNG_MYCTU61-70
 
 
 
 
 
 
  1-
-
-
-
-
K:61-70
-
Biological Unit 12 (, 0)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  0-
-
-
-
-
-
-
UNG_MYCTU61-70
 
 
 
 
 
 
  0-
-
-
-
-
-
-
Biological Unit 13 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  1-
-
-
-
-
-
M:61-70
UNG_MYCTU61-70
 
 
 
 
 
 
  1-
-
-
-
-
-
M:61-70
Biological Unit 14 (, 0)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  0-
-
-
-
-
-
-
UNG_MYCTU61-70
 
 
 
 
 
 
  0-
-
-
-
-
-
-
Biological Unit 15 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  1A:61-70
-
-
-
-
-
-
UNG_MYCTU61-70
 
 
 
 
 
 
  1A:61-70
-
-
-
-
-
-
Biological Unit 16 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  1-
C:61-70
-
-
-
-
-
UNG_MYCTU61-70
 
 
 
 
 
 
  1-
C:61-70
-
-
-
-
-
Biological Unit 17 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  1-
-
E:61-70
-
-
-
-
UNG_MYCTU61-70
 
 
 
 
 
 
  1-
-
E:61-70
-
-
-
-
Biological Unit 18 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  1-
-
-
G:61-70
-
-
-
UNG_MYCTU61-70
 
 
 
 
 
 
  1-
-
-
G:61-70
-
-
-
Biological Unit 19 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  1-
-
-
-
I:61-70
-
-
UNG_MYCTU61-70
 
 
 
 
 
 
  1-
-
-
-
I:61-70
-
-
Biological Unit 20 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  1-
-
-
-
-
K:61-70
-
UNG_MYCTU61-70
 
 
 
 
 
 
  1-
-
-
-
-
K:61-70
-
Biological Unit 21 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1U_DNA_GLYCOSYLASEPS00130 Uracil-DNA glycosylase signature.UNG_MYCTO61-70
 
 
 
 
 
 
  1-
-
-
-
-
-
M:61-70
UNG_MYCTU61-70
 
 
 
 
 
 
  1-
-
-
-
-
-
M:61-70

(-) Exons   (0, 0)

(no "Exon" information available for 2ZHX)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:225
 aligned with UNG_MYCTO | P9WFQ8 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:225
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     
            UNG_MYCTO     3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
               SCOP domains d2zhxa_ A: automated matches                                                                                                                                                                                                      SCOP domains
               CATH domains 2zhxA00 A:3-227 Uracil-DNA Glycosylase, subunit E                                                                                                                                                                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhh...hhhhhhh.hhhhhhhhhhhhhhhhhh......hhhhhhhhhhh......eeee.........................hhhhhhhhhhhhhhh.........hhhhhh..ee...................hhhhhhhhhhhhhhhh...eeeeeehhhhhh.........eeeeee...............hhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------U_DNA_GLYC------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zhx A   3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     

Chain A from PDB  Type:PROTEIN  Length:225
 aligned with UNG_MYCTU | P9WFQ9 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:225
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     
            UNG_MYCTU     3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
               SCOP domains d2zhxa_ A: automated matches                                                                                                                                                                                                      SCOP domains
               CATH domains 2zhxA00 A:3-227 Uracil-DNA Glycosylase, subunit E                                                                                                                                                                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhh...hhhhhhh.hhhhhhhhhhhhhhhhhh......hhhhhhhhhhh......eeee.........................hhhhhhhhhhhhhhh.........hhhhhh..ee...................hhhhhhhhhhhhhhhh...eeeeeehhhhhh.........eeeeee...............hhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------U_DNA_GLYC------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zhx A   3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     

Chain B from PDB  Type:PROTEIN  Length:82
 aligned with UNGI_BPPB2 | P14739 from UniProtKB/Swiss-Prot  Length:84

    Alignment length:82
                                    12        22        32        42        52        62        72        82  
           UNGI_BPPB2     3 NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML  84
               SCOP domains d2zhxb_ B: Uracil-DNA glycosylase inhibitor protein                                SCOP domains
               CATH domains 2zhxB00 B:3-84  [code=3.10.450.20, no name defined]                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh....eeeeeeehhhhhhhhhh......eeeeeee......eeeeeee......eeeeeee.....eeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                 2zhx B   3 NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML  84
                                    12        22        32        42        52        62        72        82  

Chain C from PDB  Type:PROTEIN  Length:225
 aligned with UNG_MYCTO | P9WFQ8 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:225
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     
            UNG_MYCTO     3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
               SCOP domains d2zhxc_ C: automated matches                                                                                                                                                                                                      SCOP domains
               CATH domains 2zhxC00 C:3-227 Uracil-DNA Glycosylase, subunit E                                                                                                                                                                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhhhh.hhhhhhhhhhhhhhhhhh......hhhhhhhhhhh......eee..........................hhhhhhhhhhhhhhh.........hhhhhh..ee...................hhhhhhhhhhhhhhhh...eeeeeehhhhhh.........eeeeee...hhhhhh......hhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------U_DNA_GLYC------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zhx C   3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     

Chain C from PDB  Type:PROTEIN  Length:225
 aligned with UNG_MYCTU | P9WFQ9 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:225
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     
            UNG_MYCTU     3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
               SCOP domains d2zhxc_ C: automated matches                                                                                                                                                                                                      SCOP domains
               CATH domains 2zhxC00 C:3-227 Uracil-DNA Glycosylase, subunit E                                                                                                                                                                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhhhh.hhhhhhhhhhhhhhhhhh......hhhhhhhhhhh......eee..........................hhhhhhhhhhhhhhh.........hhhhhh..ee...................hhhhhhhhhhhhhhhh...eeeeeehhhhhh.........eeeeee...hhhhhh......hhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------U_DNA_GLYC------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zhx C   3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     

Chain D from PDB  Type:PROTEIN  Length:82
 aligned with UNGI_BPPB2 | P14739 from UniProtKB/Swiss-Prot  Length:84

    Alignment length:82
                                    12        22        32        42        52        62        72        82  
           UNGI_BPPB2     3 NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML  84
               SCOP domains d2zhxd_ D: Uracil-DNA glycosylase inhibitor protein                                SCOP domains
               CATH domains 2zhxD00 D:3-84  [code=3.10.450.20, no name defined]                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhh....eeeeeeehhhhhhhhhh......eeeeeee......eeeeee.......eeeeeee.....eeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                 2zhx D   3 NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML  84
                                    12        22        32        42        52        62        72        82  

Chain E from PDB  Type:PROTEIN  Length:224
 aligned with UNG_MYCTO | P9WFQ8 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:224
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223    
            UNG_MYCTO     4 RPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
               SCOP domains d2zhxe_ E: automated matches                                                                                                                                                                                                     SCOP domains
               CATH domains 2zhxE00 E:4-227 Uracil-DNA Glycosylase, subunit E                                                                                                                                                                                CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhh..hhhhhhh.hhhhhhhhhhhhhhhhhh......hhhhhhhhhhh......eeee.........................hhhhhhhhhhhhhhh.........hhhhhh..ee...................hhhhhhhhhhhhhhhh...eeeeeehhhhhh.........eeeeee...hhhhhh......hhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------U_DNA_GLYC------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zhx E   4 RPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223    

Chain E from PDB  Type:PROTEIN  Length:224
 aligned with UNG_MYCTU | P9WFQ9 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:224
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223    
            UNG_MYCTU     4 RPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
               SCOP domains d2zhxe_ E: automated matches                                                                                                                                                                                                     SCOP domains
               CATH domains 2zhxE00 E:4-227 Uracil-DNA Glycosylase, subunit E                                                                                                                                                                                CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhh..hhhhhhh.hhhhhhhhhhhhhhhhhh......hhhhhhhhhhh......eeee.........................hhhhhhhhhhhhhhh.........hhhhhh..ee...................hhhhhhhhhhhhhhhh...eeeeeehhhhhh.........eeeeee...hhhhhh......hhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------U_DNA_GLYC------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zhx E   4 RPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223    

Chain F from PDB  Type:PROTEIN  Length:82
 aligned with UNGI_BPPB2 | P14739 from UniProtKB/Swiss-Prot  Length:84

    Alignment length:82
                                    12        22        32        42        52        62        72        82  
           UNGI_BPPB2     3 NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML  84
               SCOP domains d2zhxf_ F: Uracil-DNA glycosylase inhibitor protein                                SCOP domains
               CATH domains 2zhxF00 F:3-84  [code=3.10.450.20, no name defined]                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhh......eeeeehhhhhhhhhh......eeeeeee......eeeeeee......eeeeeee.....eeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                 2zhx F   3 NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML  84
                                    12        22        32        42        52        62        72        82  

Chain G from PDB  Type:PROTEIN  Length:225
 aligned with UNG_MYCTO | P9WFQ8 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:225
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     
            UNG_MYCTO     3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
               SCOP domains d2zhxg_ G: automated matches                                                                                                                                                                                                      SCOP domains
               CATH domains 2zhxG00 G:3-227 Uracil-DNA Glycosylase, subunit E                                                                                                                                                                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhhhh.hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhh......eeee.........................hhhhhhhhhhhhhhh.........hhhhhh..ee...................hhhhhhhhhhhhhhhh...eeeeeehhhhhh.........eeeeee...hhhhhh......hhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------U_DNA_GLYC------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zhx G   3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     

Chain G from PDB  Type:PROTEIN  Length:225
 aligned with UNG_MYCTU | P9WFQ9 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:225
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     
            UNG_MYCTU     3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
               SCOP domains d2zhxg_ G: automated matches                                                                                                                                                                                                      SCOP domains
               CATH domains 2zhxG00 G:3-227 Uracil-DNA Glycosylase, subunit E                                                                                                                                                                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhhhh.hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhh......eeee.........................hhhhhhhhhhhhhhh.........hhhhhh..ee...................hhhhhhhhhhhhhhhh...eeeeeehhhhhh.........eeeeee...hhhhhh......hhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------U_DNA_GLYC------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zhx G   3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     

Chain H from PDB  Type:PROTEIN  Length:82
 aligned with UNGI_BPPB2 | P14739 from UniProtKB/Swiss-Prot  Length:84

    Alignment length:82
                                    12        22        32        42        52        62        72        82  
           UNGI_BPPB2     3 NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML  84
               SCOP domains d2zhxh_ H: Uracil-DNA glycosylase inhibitor protein                                SCOP domains
               CATH domains 2zhxH00 H:3-84  [code=3.10.450.20, no name defined]                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhh.......eeeeehhhhhhhhhh......eeeeeee......eeeeee.......eeeeeee.....eeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                 2zhx H   3 NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML  84
                                    12        22        32        42        52        62        72        82  

Chain I from PDB  Type:PROTEIN  Length:225
 aligned with UNG_MYCTO | P9WFQ8 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:225
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     
            UNG_MYCTO     3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
               SCOP domains d2zhxi_ I: automated matches                                                                                                                                                                                                      SCOP domains
               CATH domains 2zhxI00 I:3-227 Uracil-DNA Glycosylase, subunit E                                                                                                                                                                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhhhh.hhhhhhhhhhhhhhhhhh......hhhhhhhhhhh......eeee.........................hhhhhhhhhhhhhhh.........hhhhhh..ee....................hhhhhhhhhhhhhhh...eeeeeehhhhhhhhhhh....eeeeee...............hhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------U_DNA_GLYC------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zhx I   3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     

Chain I from PDB  Type:PROTEIN  Length:225
 aligned with UNG_MYCTU | P9WFQ9 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:225
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     
            UNG_MYCTU     3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
               SCOP domains d2zhxi_ I: automated matches                                                                                                                                                                                                      SCOP domains
               CATH domains 2zhxI00 I:3-227 Uracil-DNA Glycosylase, subunit E                                                                                                                                                                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhhhh.hhhhhhhhhhhhhhhhhh......hhhhhhhhhhh......eeee.........................hhhhhhhhhhhhhhh.........hhhhhh..ee....................hhhhhhhhhhhhhhh...eeeeeehhhhhhhhhhh....eeeeee...............hhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------U_DNA_GLYC------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zhx I   3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     

Chain J from PDB  Type:PROTEIN  Length:82
 aligned with UNGI_BPPB2 | P14739 from UniProtKB/Swiss-Prot  Length:84

    Alignment length:82
                                    12        22        32        42        52        62        72        82  
           UNGI_BPPB2     3 NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML  84
               SCOP domains d2zhxj_ J: Uracil-DNA glycosylase inhibitor protein                                SCOP domains
               CATH domains 2zhxJ00 J:3-84  [code=3.10.450.20, no name defined]                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhh.....eeeeeeehhhhhhhhhh......eeeeeee.....eeeeeeee......eeeeeeee.......ee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                 2zhx J   3 NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML  84
                                    12        22        32        42        52        62        72        82  

Chain K from PDB  Type:PROTEIN  Length:225
 aligned with UNG_MYCTO | P9WFQ8 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:225
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     
            UNG_MYCTO     3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
               SCOP domains d2zhxk_ K: automated matches                                                                                                                                                                                                      SCOP domains
               CATH domains 2zhxK00 K:3-227 Uracil-DNA Glycosylase, subunit E                                                                                                                                                                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhh...hhhhhhh.hhhhhhhhhhhhhhhhhh......hhhhhhhhhhh......eee..........................hhhhhhhhhhhhhhh.........hhhhhh..ee...................hhhhhhhhhhhhhhhh...eeeeeehhhhhh.........eeeeee...hhhhhh......hhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------U_DNA_GLYC------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zhx K   3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     

Chain K from PDB  Type:PROTEIN  Length:225
 aligned with UNG_MYCTU | P9WFQ9 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:225
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     
            UNG_MYCTU     3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
               SCOP domains d2zhxk_ K: automated matches                                                                                                                                                                                                      SCOP domains
               CATH domains 2zhxK00 K:3-227 Uracil-DNA Glycosylase, subunit E                                                                                                                                                                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhh...hhhhhhh.hhhhhhhhhhhhhhhhhh......hhhhhhhhhhh......eee..........................hhhhhhhhhhhhhhh.........hhhhhh..ee...................hhhhhhhhhhhhhhhh...eeeeeehhhhhh.........eeeeee...hhhhhh......hhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------U_DNA_GLYC------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zhx K   3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     

Chain L from PDB  Type:PROTEIN  Length:82
 aligned with UNGI_BPPB2 | P14739 from UniProtKB/Swiss-Prot  Length:84

    Alignment length:82
                                    12        22        32        42        52        62        72        82  
           UNGI_BPPB2     3 NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML  84
               SCOP domains d2zhxl_ L: Uracil-DNA glycosylase inhibitor protein                                SCOP domains
               CATH domains 2zhxL00 L:3-84  [code=3.10.450.20, no name defined]                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhh.....eeeeeeehhhhhhhhhh......eeeeeee......eeeeee.......eeeeeee.....eeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                 2zhx L   3 NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML  84
                                    12        22        32        42        52        62        72        82  

Chain M from PDB  Type:PROTEIN  Length:225
 aligned with UNG_MYCTO | P9WFQ8 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:225
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     
            UNG_MYCTO     3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
               SCOP domains d2zhxm_ M: automated matches                                                                                                                                                                                                      SCOP domains
               CATH domains 2zhxM00 M:3-227 Uracil-DNA Glycosylase, subunit E                                                                                                                                                                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhhhh.hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh.eeeee........................hhhhhhhhhhhhhhh.........hhhhhh..eeeee................hhhhhhhhhhhhhhhh...eeeeee..hhhhhh.......eeeeee...hhhhhh......hhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------U_DNA_GLYC------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zhx M   3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     

Chain M from PDB  Type:PROTEIN  Length:225
 aligned with UNG_MYCTU | P9WFQ9 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:225
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     
            UNG_MYCTU     3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
               SCOP domains d2zhxm_ M: automated matches                                                                                                                                                                                                      SCOP domains
               CATH domains 2zhxM00 M:3-227 Uracil-DNA Glycosylase, subunit E                                                                                                                                                                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhhhh.hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh.eeeee........................hhhhhhhhhhhhhhh.........hhhhhh..eeeee................hhhhhhhhhhhhhhhh...eeeeee..hhhhhh.......eeeeee...hhhhhh......hhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------U_DNA_GLYC------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zhx M   3 ARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVLRAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP 227
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222     

Chain N from PDB  Type:PROTEIN  Length:82
 aligned with UNGI_BPPB2 | P14739 from UniProtKB/Swiss-Prot  Length:84

    Alignment length:82
                                    12        22        32        42        52        62        72        82  
           UNGI_BPPB2     3 NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML  84
               SCOP domains d2zhxn_ N: Uracil-DNA glycosylase inhibitor protein                                SCOP domains
               CATH domains 2zhxN00 N:3-84  [code=3.10.450.20, no name defined]                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhh.......eeeeehhhhhhhhhh......eeeeeee......eeeeeee......eeeeeee.....eeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                 2zhx N   3 NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML  84
                                    12        22        32        42        52        62        72        82  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 14)

Asymmetric Unit

(-) CATH Domains  (2, 14)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2ZHX)

(-) Gene Ontology  (10, 19)

Asymmetric Unit(hide GO term definitions)
Chain A,C,E,G,I,K,M   (UNG_MYCTU | P9WFQ9)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016798    hydrolase activity, acting on glycosyl bonds    Catalysis of the hydrolysis of any glycosyl bond.
    GO:0016799    hydrolase activity, hydrolyzing N-glycosyl compounds    Catalysis of the hydrolysis of any N-glycosyl bond.
    GO:0004844    uracil DNA N-glycosylase activity    Catalysis of the cleavage of the N-C1' glycosidic bond between the damaged DNA base and the deoxyribose sugar, releasing a free base and leaving an apyrimidinic (AP) site. Enzymes with this activity recognize and remove uracil bases in DNA that result from the deamination of cytosine or the misincorporation of dUTP opposite an adenine.
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006284    base-excision repair    In base excision repair, an altered base is removed by a DNA glycosylase enzyme, followed by excision of the resulting sugar phosphate. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain A,C,E,G,I,K,M   (UNG_MYCTO | P9WFQ8)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016798    hydrolase activity, acting on glycosyl bonds    Catalysis of the hydrolysis of any glycosyl bond.
    GO:0016799    hydrolase activity, hydrolyzing N-glycosyl compounds    Catalysis of the hydrolysis of any N-glycosyl bond.
    GO:0004844    uracil DNA N-glycosylase activity    Catalysis of the cleavage of the N-C1' glycosidic bond between the damaged DNA base and the deoxyribose sugar, releasing a free base and leaving an apyrimidinic (AP) site. Enzymes with this activity recognize and remove uracil bases in DNA that result from the deamination of cytosine or the misincorporation of dUTP opposite an adenine.
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006284    base-excision repair    In base excision repair, an altered base is removed by a DNA glycosylase enzyme, followed by excision of the resulting sugar phosphate. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain B,D,F,H,J,L,N   (UNGI_BPPB2 | P14739)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2zhx)
 
  Sites
(no "Sites" information available for 2zhx)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2zhx)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]
    Biological Unit 7  [ Jena3D ]
    Biological Unit 8  [ Jena3D ]
    Biological Unit 9  [ Jena3D ]
    Biological Unit 10  [ Jena3D ]
    Biological Unit 11  [ Jena3D ]
    Biological Unit 12  [ Jena3D ]
    Biological Unit 13  [ Jena3D ]
    Biological Unit 14  [ Jena3D ]
    Biological Unit 15  [ Jena3D ]
    Biological Unit 16  [ Jena3D ]
    Biological Unit 17  [ Jena3D ]
    Biological Unit 18  [ Jena3D ]
    Biological Unit 19  [ Jena3D ]
    Biological Unit 20  [ Jena3D ]
    Biological Unit 21  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2zhx
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  UNGI_BPPB2 | P14739
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UNG_MYCTO | P9WFQ8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UNG_MYCTU | P9WFQ9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.2.2.3
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  UNGI_BPPB2 | P14739
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  UNG_MYCTO | P9WFQ8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  UNG_MYCTU | P9WFQ9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        UNGI_BPPB2 | P147391eui 1lqg 1lqm 1udi 1ugh 1ugi 1uug 2j8x 2ugi 2uug 4lyl
        UNG_MYCTO | P9WFQ83a7n
        UNG_MYCTU | P9WFQ93a7n 4wpk 4wpl 4wru 4wrv 4wrw 4wrx 4wry 4wrz 4ws0 4ws1 4ws2 4ws3 4ws4 4ws5 4ws6 4ws7 4ws8

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2ZHX)