Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  INSIGHTS FROM CRYSTAL AND SOLUTION STRUCTURES OF MOUSE UFSP1
 
Authors :  B. H. Ha, H. C. Ahn, S. H. Kang, K. Tanaka, C. H. Chung, E. E. Kim
Date :  30 Aug 07  (Deposition) - 04 Mar 08  (Release) - 07 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym./Biol. Unit :  A
Keywords :  Alpha/Beta, Papain Like Fold, Hydrolase, Protease, Thiol Protease, Ubl Conjugation Pathway (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. H. Ha, H. C. Ahn, S. H. Kang, K. Tanaka, C. H. Chung, E. E. Kim
Structural Basis For Ufm1 Processing By Ufsp1
J. Biol. Chem. V. 283 14893 2008
PubMed-ID: 18321862  |  Reference-DOI: 10.1074/JBC.M708756200

(-) Compounds

Molecule 1 - UFM1-SPECIFIC PROTEASE 1
    Chains: A
    EC Number: 3.4.22.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET22B
    Expression System Strain: ROSETTA (DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: RESIDUES 6-216
    Organism Common: HOUSE MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
    Synonym: UFSP1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2Z84)

(-) Sites  (0, 0)

(no "Site" information available for 2Z84)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2Z84)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Trp A:64 -Pro A:65

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2Z84)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2Z84)

(-) Exons   (0, 0)

(no "Exon" information available for 2Z84)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:210
 aligned with UFSP1_MOUSE | Q9CZP0 from UniProtKB/Swiss-Prot  Length:217

    Alignment length:211
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216 
          UFSP1_MOUSE     7 STLELLKDVHLGLPVPCHDPARLALLSGHYLYYHYGCDGLDDRGWGCGYRTLQTLCSWPGGQSSGVPGLPALQGALEAMGDKPPGFRGSRNWIGCVEASLCLEHFGGPQGRLCHLPRGVGLRGEEERLYSHFTTGGGPVMVGGDADAQSKALLGICEGPGSEVYVLILDPHYWGTPKNRCELQAAGWVGWQKVKSVFDSNSFYNLCFTRNL 217
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------Peptidase_C78-2z84A01 A:27-212                                                                                                                                                            ----- Pfam domains
         Sec.struct. author .....................eeee....................hhhhhhhhhhhh..........hhhhhhhhhhhh..............hhhhhhhhhhhh...eeeeeee........hhhhhhhhhhh....eee........eeeeeeee.....eeeeee.........hhhhhhhh..eeeeehhhhh.....eeeeeee-. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2z84 A   7 STLELLKDVHLGLPVPCHDPARLALLSGHYLYYHYGCDGLDDRGWGCGYRTLQTLCSWPGGQSSGVPGLPALQGALEAMGDKPPGFRGSRNWIGCVEASLCLEHFGGPQGRLCHLPRGVGLRGEEERLYSHFTTGGGPVMVGGDADAQSKALLGICEGPGSEVYVLILDPHYWGTPKNRCELQAAGWVGWQKVKSVFDSNSFYNLCFTR-L 216
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206        |-|
                                                                                                                                                                                                                                          215 |
                                                                                                                                                                                                                                            216
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2Z84)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2Z84)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: Peptidase_CA (169)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (UFSP1_MOUSE | Q9CZP0)
molecular function
    GO:0071567    UFM1 hydrolase activity    Catalysis of the hydrolysis of UFM1, a small ubiquitin-related modifier, from previously modified substrates.
    GO:0008234    cysteine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0016790    thiolester hydrolase activity    Catalysis of the reaction: RCO-SR' + H2O = RCOOH + HSR'. This reaction is the hydrolysis of a thiolester bond, an ester formed from a carboxylic acid and a thiol (i.e., RCO-SR'), such as that found in acetyl-coenzyme A.
biological process
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2z84)
 
  Sites
(no "Sites" information available for 2z84)
 
  Cis Peptide Bonds
    Trp A:64 - Pro A:65   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2z84
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  UFSP1_MOUSE | Q9CZP0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.22.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  UFSP1_MOUSE | Q9CZP0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2Z84)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2Z84)