![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2YY9) |
(no "Site" information available for 2YY9) |
(no "SS Bond" information available for 2YY9) |
(no "Cis Peptide Bond" information available for 2YY9) |
(no "SAP(SNP)/Variant" information available for 2YY9) |
Asymmetric/Biological Unit (1, 2)
|
(no "Exon" information available for 2YY9) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:106 aligned with TZAP_MOUSE | Q1H9T6 from UniProtKB/Swiss-Prot Length:681 Alignment length:114 12 22 32 42 52 62 72 82 92 102 112 TZAP_MOUSE 3 GSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQRIYGDGTGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAAKELRVPEAVELCQSFQP 116 SCOP domains d 2yy9a_ A: automated matches SCOP domains CATH domains 2 yy9A00 A:7-116 Potassium Channel Kv1.1; Chain A CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains Chain B from PDB Type:PROTEIN Length:109 aligned with TZAP_MOUSE | Q1H9T6 from UniProtKB/Swiss-Prot Length:681 Alignment length:113 11 21 31 41 51 61 71 81 91 101 111 TZAP_MOUSE 2 DGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQRIYGDGTGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAAKELRVPEAVELCQSF 114 SCOP domains d2 yy9b_ B: automated matches SCOP domains CATH domains 2y y9B00 B:6-114 Potassium Channel Kv1.1; Chain A CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------- Pfam domains
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit |
(no "Pfam Domain" information available for 2YY9) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (TZAP_MOUSE | Q1H9T6)
|
|
|
|
|
|
|