Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF LMO2642
 
Authors :  J. H. Jeong, Y. G. Kim
Date :  28 Jul 10  (Deposition) - 23 Feb 11  (Release) - 23 Mar 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Phosphodiesterase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. G. Kim, J. H. Jeong, N. C. Ha, K. J. Kim
Structural And Functional Analysis Of The Lmo2642 Cyclic Nucleotide Phosphodiesterase From Listeria Monocytogenes.
Proteins V. 79 1205 2011
PubMed-ID: 21246635  |  Reference-DOI: 10.1002/PROT.22954

(-) Compounds

Molecule 1 - LMO2642 PROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPPROEXHTB
    Expression System StrainBL21(DE3) RIL
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism ScientificLISTERIA MONOCYTOGENES
    Organism Taxid1639

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 8)

Asymmetric Unit (4, 8)
No.NameCountTypeFull Name
1CA2Ligand/IonCALCIUM ION
2FE2Ligand/IonFE (III) ION
3MN2Ligand/IonMANGANESE (II) ION
4PO42Ligand/IonPHOSPHATE ION
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2FE-1Ligand/IonFE (III) ION
3MN-1Ligand/IonMANGANESE (II) ION
4PO41Ligand/IonPHOSPHATE ION
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2FE-1Ligand/IonFE (III) ION
3MN-1Ligand/IonMANGANESE (II) ION
4PO41Ligand/IonPHOSPHATE ION

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:47 , HIS A:49 , ASP A:101 , HIS A:283 , FE A:556 , PO4 A:1444 , HOH A:2284BINDING SITE FOR RESIDUE MN A 555
2AC2SOFTWAREASP A:101 , ASN A:134 , HIS A:243 , HIS A:281 , MN A:555 , PO4 A:1444 , HOH A:2284BINDING SITE FOR RESIDUE FE A 556
3AC3SOFTWAREGLU A:122 , ASP A:167 , HOH A:2031 , HOH A:2080 , HOH A:2104 , HOH A:2111BINDING SITE FOR RESIDUE CA A 600
4AC4SOFTWAREASP B:47 , HIS B:49 , ASP B:101 , HIS B:283 , FE B:556 , PO4 B:1444 , HOH B:2240BINDING SITE FOR RESIDUE MN B 555
5AC5SOFTWAREASP B:101 , ASN B:134 , HIS B:243 , HIS B:281 , MN B:555 , PO4 B:1444 , HOH B:2240BINDING SITE FOR RESIDUE FE B 556
6AC6SOFTWAREGLU B:122 , ASP B:167 , HOH B:2015 , HOH B:2053 , HOH B:2081 , HOH B:2087BINDING SITE FOR RESIDUE CA B 600
7AC7SOFTWAREHIS A:49 , ASP A:101 , ASN A:134 , HIS A:135 , TYR A:257 , HIS A:281 , HIS A:283 , MN A:555 , FE A:556 , HOH A:2284 , HOH A:2285 , HOH A:2286 , HOH A:2287 , HOH A:2288BINDING SITE FOR RESIDUE PO4 A1444
8AC8SOFTWAREHIS B:49 , ASP B:101 , ASN B:134 , HIS B:135 , TYR B:257 , HIS B:281 , HIS B:283 , MN B:555 , FE B:556 , HOH B:2240 , HOH B:2241 , HOH B:2242BINDING SITE FOR RESIDUE PO4 B1444

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2XMO)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Phe A:309 -Pro A:310
2Phe B:309 -Pro B:310

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2XMO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2XMO)

(-) Exons   (0, 0)

(no "Exon" information available for 2XMO)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:409
 aligned with Q8Y432_LISMO | Q8Y432 from UniProtKB/TrEMBL  Length:443

    Alignment length:411
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442 
         Q8Y432_LISMO    33 PIEKDRNLSMVVTTDVHYFAPSLTDNGKAFEKYVAAGDGKQLAYSDEITDAFLADVESKKTDVLIISGDLTNNGEKTSHEELAKKLTQVEKNGTQVFVVPGNHDINNPWARKFEKDKQLPTDTISPTDFSKIYGDFGYEDAISSDEFSLSYLAAPSSKVWLLMLDTAIYKTNMQQGNPTTEGGLTAGTLDWIKESSALAKKNGAKLIPVLHHNLTDHNDVIQKGYTINYNQQVIDALTEGAMDFSLSGHIHTQNIRSAKSTDGKEITDIVTNALSVFPHKYGNITYSAKNKNFTYQSQKLDMEAWAKAQGSTDENLLNFDQFDYETFYNSGYDKAMMDLMTDESYDKYNQADKEKMADTMGLNNMYFFAGTAPPKSDGMALWDSAPNSFLKDYVLSSSNPPKKSNDYYVSP 443
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeee......hhhh...hhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh..eeeee.......hhhhhhhhhhhhhhhhhh..eeeee...........eeee..eeee....hhhhhhhhhhhhhhh...ee......eee.....eeeee.......hhhhhh........hhhhhhhhhhhhhhhhhh..eeeee...........--......hhhhhhhhhhhh...eeee......eeeeee.....eeeeee.........eeeeeeee....eeeeeeee.hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhh..hhhhhhhhhh.........eee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2xmo A  33 PIEKDRNLSMVVTTDVHYFAPSLTDNGKAFEKYVAAGDGKQLAYSDEITDAFLADVESKKTDVLIISGDLTNNGEKTSHEELAKKLTQVEKNGTQVFVVPGNHDINNPWARKFEKDKQLPTDTISPTDFSKIYSDFGYEDAISSDEFSLSYLAAPSSKVWLLMLDTAIYKTNMQQGNPTTEGGLTAGTLDWIKESSALAKKNGAKLIPVLHHNLTDHNDV--KGYTINYNQQVIDALTEGAMDFSLSGHIHTQNIRSAKSTDGKEITDIVTNALSVFPHKYGNITYSAKNKNFTYQSQKLDMEAWAKAQGSTDENLLNFDQFDYETFYNSGYDKAMMDLMTDESYDKYNQADKEKMADTMGLNNMYFFAGTAPPKSDGMALWDSAPNSFLKDYVLSSSNPPKKSNDYYVSP 443
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252  |    262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442 
                                                                                                                                                                                                                                                     252  |                                                                                                                                                                                            
                                                                                                                                                                                                                                                        255                                                                                                                                                                                            

Chain B from PDB  Type:PROTEIN  Length:409
 aligned with Q8Y432_LISMO | Q8Y432 from UniProtKB/TrEMBL  Length:443

    Alignment length:410
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443
         Q8Y432_LISMO    34 IEKDRNLSMVVTTDVHYFAPSLTDNGKAFEKYVAAGDGKQLAYSDEITDAFLADVESKKTDVLIISGDLTNNGEKTSHEELAKKLTQVEKNGTQVFVVPGNHDINNPWARKFEKDKQLPTDTISPTDFSKIYGDFGYEDAISSDEFSLSYLAAPSSKVWLLMLDTAIYKTNMQQGNPTTEGGLTAGTLDWIKESSALAKKNGAKLIPVLHHNLTDHNDVIQKGYTINYNQQVIDALTEGAMDFSLSGHIHTQNIRSAKSTDGKEITDIVTNALSVFPHKYGNITYSAKNKNFTYQSQKLDMEAWAKAQGSTDENLLNFDQFDYETFYNSGYDKAMMDLMTDESYDKYNQADKEKMADTMGLNNMYFFAGTAPPKSDGMALWDSAPNSFLKDYVLSSSNPPKKSNDYYVSP 443
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ------Metallophos-2xmoB01 B:40-285                                                                                                                                                                                                                          -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ------Metallophos-2xmoB02 B:40-285                                                                                                                                                                                                                          -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (2)
         Sec.struct. author ......eeeeee......hhhh...hhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh..eeeee.......hhhhhhhhhhhhhhhhhh..eeeee...........eeee..eeee....hhhhhhhhhhhhhhh...ee......eee.....eeeee.......hhhhhh........hhhhhhhhhhhhhhhhhh..eeeeee..........-.......hhhhhhhhhhhh...eeee......eeeeee.....eeeeee.........eeeeeeee....eeeeeeee.hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhh..hhhhhhhhhh.........eee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2xmo B  34 IEKDRNLSMVVTTDVHYFAPSLTDNGKAFEKYVAAGDGKQLAYSDEITDAFLADVESKKTDVLIISGDLTNNGEKTSHEELAKKLTQVEKNGTQVFVVPGNHDINNPWARKFEKDKQLPTDTISPTDFSKIYSDFGYEDAISSDEFSLSYLAAPSSKVWLLMLDTAIYKTNMQQGNPTTEGGLTAGTLDWIKESSALAKKNGAKLIPVLHHNLTDHNDV-QKGYTINYNQQVIDALTEGAMDFSLSGHIHTQNIRSAKSTDGKEITDIVTNALSVFPHKYGNITYSAKNKNFTYQSQKLDMEAWAKAQGSTDENLLNFDQFDYETFYNSGYDKAMMDLMTDESYDKYNQADKEKMADTMGLNNMYFFAGTAPPKSDGMALWDSAPNSFLKDYVLSSSNPPKKSNDYYVSP 443
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243        |-|      263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443
                                                                                                                                                                                                                                                    252 |                                                                                                                                                                                             
                                                                                                                                                                                                                                                      254                                                                                                                                                                                             

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2XMO)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2XMO)

(-) Pfam Domains  (1, 2)

Asymmetric Unit

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q8Y432_LISMO | Q8Y432)
molecular function
    GO:0004115    3',5'-cyclic-AMP phosphodiesterase activity    Catalysis of the reaction: adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Phe A:309 - Pro A:310   [ RasMol ]  
    Phe B:309 - Pro B:310   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2xmo
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8Y432_LISMO | Q8Y432
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q8Y432_LISMO | Q8Y432
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2XMO)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2XMO)