|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 9)
Asymmetric Unit (1, 9)
|
Sites (0, 0)| (no "Site" information available for 2VGY) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2VGY) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2VGY) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2VGY) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2VGY) |
Exons (0, 0)| (no "Exon" information available for 2VGY) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:132 aligned with O87496_YEREN | O87496 from UniProtKB/TrEMBL Length:168 Alignment length:132 38 48 58 68 78 88 98 108 118 128 138 148 158 O87496_YEREN 29 NEISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKELSTRVSSMLEAIKLKKEM 160 SCOP domains ------------------------------------------------------------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains -------TPR_3-2vgyA01 A:36-69 ------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript 2vgy A 29 NEISSDTLEQLYSLAFNQYQSGkYEDAHkVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYEEGAVMDIkEPRFPFHAAECLLQkGELAEAESGLFLAQELIANkPEFkELSTRVSSMLEAIkLkkEM 160 38 48 | 58 68 78 88 98 | 108 118 128 138 | 148 |158 51-MLY | 102-MLY 117-MLY 137-MLY 155-MLY 57-MLY 141-MLY 157-MLY 158-MLY
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2VGY) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2VGY) |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A (O87496_YEREN | O87496)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|