Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE RHODOCOCCUS HALOALKANE DEHALOGENASE MUTANT WITH ENHANCED ENANTIOSELECTIVITY
 
Authors :  T. Koudelakova, Z. Prokop, Y. Sato, M. Lapkouski, E. Chovancova, M. Mon A. Jesenska, J. Emmer, T. Senda, Y. Nagata, I. Kuta Smatanova, J. Damb
Date :  28 Aug 07  (Deposition) - 16 Sep 08  (Release) - 28 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym./Biol. Unit :  A
Keywords :  Plasmid, Hydrolase, Detoxification (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. Koudelakova, Z. Prokop, Y. Sato, M. Lapkouski, E. Chovancova, M. Monincova, A. Jesenska, J. Emmer, T. Senda, Y. Nagata, I. Kuta Smatanova, J. Damborsky
Rational Engineering Of Rhodococcus Haloalkane Dehalogenase With Enhanced Enantioselectivity
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - HALOALKANE DEHALOGENASE
    Chains: A
    EC Number: 3.8.1.5
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector: PET21B
    Mutation: YES
    Organism Scientific: RHODOCOCCUS RHODOCHROUS
    Organism Taxid: 1829
    Strain: NCIMB13064
    Synonym: HALOALKANE DEHALOGENASE DHAA12

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2V9Z)

(-) Sites  (0, 0)

(no "Site" information available for 2V9Z)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2V9Z)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1Asn A:41 -Pro A:42
2Glu A:214 -Pro A:215
3Thr A:242 -Pro A:243

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2V9Z)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2V9Z)

(-) Exons   (0, 0)

(no "Exon" information available for 2V9Z)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:302
 aligned with DHAA_RHORH | P0A3G2 from UniProtKB/Swiss-Prot  Length:293

    Alignment length:302
                                                                                                                                                                     142         143                                                                                                                                                      
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142         - |     151       161       171       181       191       201       211       221       231       241       251       261       271       281       291  
          DHAA_RHORH      3 EIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWP-----------EFARETFQAFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPAL  293
               SCOP domains d2v9za_ A: automated matches                                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains 2v9zA00 A:3-293  [code=3.40.50.1820, no name defined]                                                                                                                                                                                                                                                          CATH domains
               Pfam domains --------------------------------Abhydrolase_6-2v9zA01 A:35-285                                                                                                                                                                                                                                        -------- Pfam domains
         Sec.struct. author ..........eeee....eeee.ee.......eeee.....hhhhhh.hhhhhh....ee..................hhhhhhhhhhhhhhh....eeeee..hhhhhhhhhhhhhhh.eeeeeee................hhhhhhhhhhhhhhhhhhh...hhhhhhh..hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh...eeeeeeee....hhhhhhhhhhhh..eeeeeeeee..hhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2v9z A    3 EIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEFHHTEVAEEQDHAEAARETFQAFRTADVGRELIIDQNAFIERVLPGGVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGALIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPAL  293
                                    12        22        32        42        52        62        72        82        92       102       112       122       132      141A||||||141K       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291  
                                                                                                                                                                    141A|||||141J|                                                                                                                                                        
                                                                                                                                                                     141B|||||141K                                                                                                                                                        
                                                                                                                                                                      141C||||||                                                                                                                                                          
                                                                                                                                                                       141D|||||                                                                                                                                                          
                                                                                                                                                                        141E||||                                                                                                                                                          
                                                                                                                                                                         141F|||                                                                                                                                                          
                                                                                                                                                                          141G||                                                                                                                                                          
                                                                                                                                                                           141H|                                                                                                                                                          
                                                                                                                                                                            141I
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: AB_hydrolase (347)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (DHAA_RHORH | P0A3G2)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0018786    haloalkane dehalogenase activity    Catalysis of the reaction: 1-haloalkane + H2O = a primary alcohol + halide.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
biological process
    GO:0009636    response to toxic substance    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a toxic stimulus.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2v9z)
 
  Sites
(no "Sites" information available for 2v9z)
 
  Cis Peptide Bonds
    Asn A:41 - Pro A:42   [ RasMol ]  
    Glu A:214 - Pro A:215   [ RasMol ]  
    Thr A:242 - Pro A:243   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2v9z
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DHAA_RHORH | P0A3G2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.8.1.5
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  DHAA_RHORH | P0A3G2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DHAA_RHORH | P0A3G2: 3fbw 3rk4 3sk0 4e46 4f5z 4f60 4fwb 4wcv 5flk 5uxz 5uy1 5vnp

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2V9Z)