Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE TRIMERIC NECK AND CARBOHYDRATE RECOGNITION DOMAIN OF HUMAN SURFACTANT PROTEIN D IN COMPLEX WITH L-GLYCERO-D-MANNO-HEPTOSE
 
Authors :  H. Wang, J. Head, P. Kosma, S. Sheikh, B. Mcdonald, K. Smith, T. Cafarella, B. Seaton, E. Crouch
Date :  10 Oct 07  (Deposition) - 15 Jan 08  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Surfactant Protein; Carbohydrate Recognition; Domain Trimeric, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Wang, J. Head, P. Kosma, H. Brade, S. Muller-Loennies, S. Sheikh, B. Mcdonald, K. Smith, T. Cafarella, B. Seaton, E. Crouch
Recognition Of Heptoses And The Inner Core Of Bacterial Lipopolysaccharides By Surfactant Protein D.
Biochemistry V. 47 710 2008
PubMed-ID: 18092821  |  Reference-DOI: 10.1021/BI7020553
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PULMONARY SURFACTANT-ASSOCIATED PROTEIN D
    ChainsA, B, C
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET30A(+)
    Expression System StrainROSETTABLUE
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentNECK AND CARBOHYDRATE RECOGNITION DOMAIN
    GeneSFTPD, PSPD, SFTP4
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymSP-D;
PSP-D;
LUNG SURFACTANT PROTEIN D

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 12)

Asymmetric/Biological Unit (2, 12)
No.NameCountTypeFull Name
1CA9Ligand/IonCALCIUM ION
2GMH3Ligand/IonL-GLYCERO-D-MANNO-HEPTOPYRANOSE

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLU A:321 , ASN A:323 , GLU A:329 , ASN A:341 , ASP A:342 , GMH A:356BINDING SITE FOR RESIDUE CA A 401
02AC2SOFTWAREASP A:297 , GLU A:301 , ASP A:324 , GLU A:329 , ASP A:330 , HOH A:528BINDING SITE FOR RESIDUE CA A 402
03AC3SOFTWAREGLU A:301 , ASP A:330 , HOH A:407 , HOH A:540 , HOH A:547 , HOH A:548BINDING SITE FOR RESIDUE CA A 403
04AC4SOFTWAREGLU A:321 , ASN A:323 , ASP A:325 , GLU A:329 , ASN A:341 , ASP A:342 , ARG A:343 , CA A:401 , HOH A:438 , HOH A:504BINDING SITE FOR RESIDUE GMH A 356
05AC5SOFTWAREGLU B:321 , ASN B:323 , GLU B:329 , ASN B:341 , ASP B:342 , GMH B:356BINDING SITE FOR RESIDUE CA B 401
06AC6SOFTWAREASP B:297 , GLU B:301 , ASP B:324 , GLU B:329 , ASP B:330 , HOH B:544BINDING SITE FOR RESIDUE CA B 402
07AC7SOFTWAREGLU B:301 , ASP B:330 , HOH B:545 , HOH B:546 , HOH B:548 , HOH B:564BINDING SITE FOR RESIDUE CA B 403
08AC8SOFTWAREGLU B:321 , ASN B:323 , ASP B:325 , GLU B:329 , ASN B:341 , ASP B:342 , ARG B:343 , CA B:401 , HOH B:412 , HOH B:431 , HOH B:476 , SER C:226BINDING SITE FOR RESIDUE GMH B 356
09AC9SOFTWAREGLU C:321 , ASN C:323 , GLU C:329 , ASN C:341 , ASP C:342 , GMH C:356BINDING SITE FOR RESIDUE CA C 401
10BC1SOFTWAREASP C:297 , GLU C:301 , ASP C:324 , GLU C:329 , ASP C:330 , HOH C:523BINDING SITE FOR RESIDUE CA C 402
11BC2SOFTWAREGLU C:301 , ASP C:330 , HOH C:482 , HOH C:524 , HOH C:536 , HOH C:537BINDING SITE FOR RESIDUE CA C 403
12BC3SOFTWARESER A:226 , HOH A:422 , GLU C:321 , ASN C:323 , ASP C:325 , GLU C:329 , ASN C:341 , ASP C:342 , ARG C:343 , CA C:401 , HOH C:435 , HOH C:497BINDING SITE FOR RESIDUE GMH C 356

(-) SS Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1A:261 -A:353
2A:331 -A:345
3B:261 -B:353
4B:331 -B:345
5C:261 -C:353
6C:331 -C:345

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Phe A:234 -Pro A:235
2Glu A:321 -Pro A:322
3Phe B:234 -Pro B:235
4Glu B:321 -Pro B:322
5Phe C:234 -Pro C:235
6Glu C:321 -Pro C:322

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 6)

Asymmetric/Biological Unit (2, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_020940S290TSFTPD_HUMANPolymorphism3088308A/B/CS270T
2UniProtVAR_020941E309KSFTPD_HUMANPolymorphism4469829A/B/CE289K

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 6)

Asymmetric/Biological Unit (2, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1C_TYPE_LECTIN_2PS50041 C-type lectin domain profile.SFTPD_HUMAN272-374
 
 
  3A:252-354
B:252-354
C:252-354
2C_TYPE_LECTIN_1PS00615 C-type lectin domain signature.SFTPD_HUMAN351-373
 
 
  3A:331-353
B:331-353
C:331-353

(-) Exons   (2, 6)

Asymmetric/Biological Unit (2, 6)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2ENST000003722922ENSE00001457451chr10:81708859-8170882238SFTPD_HUMAN-00--
1.3ENST000003722923ENSE00001679030chr10:81706418-81706217202SFTPD_HUMAN1-67670--
1.4ENST000003722924ENSE00001388162chr10:81702635-81702519117SFTPD_HUMAN67-106400--
1.5ENST000003722925ENSE00000909268chr10:81702260-81702144117SFTPD_HUMAN106-145400--
1.6ENST000003722926ENSE00000909267chr10:81701826-81701710117SFTPD_HUMAN145-184400--
1.7bENST000003722927bENSE00002173050chr10:81701270-81701154117SFTPD_HUMAN184-223400--
1.8ENST000003722928ENSE00001708197chr10:81700544-8170046184SFTPD_HUMAN223-251293A:206-231
B:204-231
C:206-231
26
28
26
1.9ENST000003722929ENSE00001920473chr10:81697984-81697496489SFTPD_HUMAN251-3751253A:231-355
B:231-355
C:231-355
125
125
125

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:150
 aligned with SFTPD_HUMAN | P35247 from UniProtKB/Swiss-Prot  Length:375

    Alignment length:150
                                   235       245       255       265       275       285       295       305       315       325       335       345       355       365       375
          SFTPD_HUMAN   226 SLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF 375
               SCOP domains d2riba2 A:206-234            d2riba1 A:235-355 automated matches                                                                                       SCOP domains
               CATH domains 2ribA00 A:206-355 Mannose-Binding Protein A, subunit A                                                                                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeee..eeeeeeeeeeehhhhhhhhhhh..ee....hhhhhhhhhhhhhhhh..ee...............................hhhhh..eeee.....eeee....eeeeeeee Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------T------------------K------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ----------------------------------------------C_TYPE_LECTIN_2  PDB: A:252-354 UniProt: 272-374                                                       - PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------------------------------------------------C_TYPE_LECTIN_1        -- PROSITE (2)
           Transcript 1 (1) Exon 1.8  PDB: A:206-231  ---------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------Exon 1.9  PDB: A:231-355 UniProt: 251-375                                                                                     Transcript 1 (2)
                 2rib A 206 SLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF 355
                                   215       225       235       245       255       265       275       285       295       305       315       325       335       345       355

Chain B from PDB  Type:PROTEIN  Length:152
 aligned with SFTPD_HUMAN | P35247 from UniProtKB/Swiss-Prot  Length:375

    Alignment length:152
                                   233       243       253       263       273       283       293       303       313       323       333       343       353       363       373  
          SFTPD_HUMAN   224 VASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF 375
               SCOP domains d2ribb2 B:204-234              d2ribb1 B:235-355 automated matches                                                                                       SCOP domains
               CATH domains 2ribB00 B:204-355 Mannose-Binding Protein A, subunit A                                                                                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeee..eeeeeeeeeeehhhhhhhhhhh..ee....hhhhhhhhhhhhhhhh..ee...............................hhhhh..eeee.....eeee....eeeeeeee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------T------------------K------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ------------------------------------------------C_TYPE_LECTIN_2  PDB: B:252-354 UniProt: 272-374                                                       - PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------C_TYPE_LECTIN_1        -- PROSITE (2)
           Transcript 1 (1) Exon 1.8  PDB: B:204-231    ---------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------Exon 1.9  PDB: B:231-355 UniProt: 251-375                                                                                     Transcript 1 (2)
                 2rib B 204 VASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF 355
                                   213       223       233       243       253       263       273       283       293       303       313       323       333       343       353  

Chain C from PDB  Type:PROTEIN  Length:150
 aligned with SFTPD_HUMAN | P35247 from UniProtKB/Swiss-Prot  Length:375

    Alignment length:150
                                   235       245       255       265       275       285       295       305       315       325       335       345       355       365       375
          SFTPD_HUMAN   226 SLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF 375
               SCOP domains d2ribc2 C:206-234            d2ribc1 C:235-355 automated matches                                                                                       SCOP domains
               CATH domains 2ribC00 C:206-355 Mannose-Binding Protein A, subunit A                                                                                                 CATH domains
           Pfam domains (1) Surfac_D-trimer-2ribC04 C:206-249           -Lectin_C-2ribC01 C:251-355                                                                                Pfam domains (1)
           Pfam domains (2) Surfac_D-trimer-2ribC05 C:206-249           -Lectin_C-2ribC02 C:251-355                                                                                Pfam domains (2)
           Pfam domains (3) Surfac_D-trimer-2ribC06 C:206-249           -Lectin_C-2ribC03 C:251-355                                                                                Pfam domains (3)
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeee..eeeeeeeeeeehhhhhhhhhhh..ee....hhhhhhhhhhhhhhhh..ee...............................hhhhh..eeee.....eeee....eeeeeeee Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------T------------------K------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ----------------------------------------------C_TYPE_LECTIN_2  PDB: C:252-354 UniProt: 272-374                                                       - PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------------------------------------------------C_TYPE_LECTIN_1        -- PROSITE (2)
           Transcript 1 (1) Exon 1.8  PDB: C:206-231  ---------------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------Exon 1.9  PDB: C:231-355 UniProt: 251-375                                                                                     Transcript 1 (2)
                 2rib C 206 SLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF 355
                                   215       225       235       245       255       265       275       285       295       305       315       325       335       345       355

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 6)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (2, 6)

Asymmetric/Biological Unit
(-)
Clan: C_Lectin (98)

(-) Gene Ontology  (27, 27)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C   (SFTPD_HUMAN | P35247)
molecular function
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0044267    cellular protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
    GO:0042742    defense response to bacterium    Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0048286    lung alveolus development    The process whose specific outcome is the progression of the alveolus over time, from its formation to the mature structure. The alveolus is a sac for holding air in the lungs; formed by the terminal dilation of air passageways.
    GO:0048246    macrophage chemotaxis    The movement of a macrophage in response to an external stimulus.
    GO:0042130    negative regulation of T cell proliferation    Any process that stops, prevents or reduces the rate or extent of T cell proliferation.
    GO:0045085    negative regulation of interleukin-2 biosynthetic process    Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of interleukin-2.
    GO:0050766    positive regulation of phagocytosis    Any process that activates or increases the frequency, rate or extent of phagocytosis.
    GO:0072593    reactive oxygen species metabolic process    The chemical reactions and pathways involving a reactive oxygen species, any molecules or ions formed by the incomplete one-electron reduction of oxygen. They contribute to the microbicidal activity of phagocytes, regulation of signal transduction and gene expression, and the oxidative damage to biopolymers.
    GO:0006898    receptor-mediated endocytosis    An endocytosis process in which cell surface receptors ensure specificity of transport. A specific receptor on the cell surface binds tightly to the extracellular macromolecule (the ligand) that it recognizes; the plasma-membrane region containing the receptor-ligand complex then undergoes endocytosis, forming a transport vesicle containing the receptor-ligand complex and excluding most other plasma-membrane proteins. Receptor-mediated endocytosis generally occurs via clathrin-coated pits and vesicles.
    GO:0001817    regulation of cytokine production    Any process that modulates the frequency, rate, or extent of production of a cytokine.
    GO:0050776    regulation of immune response    Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
    GO:0007585    respiratory gaseous exchange    The process of gaseous exchange between an organism and its environment. In plants, microorganisms, and many small animals, air or water makes direct contact with the organism's cells or tissue fluids, and the processes of diffusion supply the organism with dioxygen (O2) and remove carbon dioxide (CO2). In larger animals the efficiency of gaseous exchange is improved by specialized respiratory organs, such as lungs and gills, which are ventilated by breathing mechanisms.
    GO:0043129    surfactant homeostasis    Any process involved in the maintenance of a steady-state level of the surface-active lipoprotein mixture which coats the alveoli.
cellular component
    GO:0045334    clathrin-coated endocytic vesicle    A clathrin-coated, membrane-bounded intracellular vesicle formed by invagination of the plasma membrane around an extracellular substance.
    GO:0005581    collagen trimer    A protein complex consisting of three collagen chains assembled into a left-handed triple helix. These trimers typically assemble into higher order structures.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0030139    endocytic vesicle    A membrane-bounded intracellular vesicle formed by invagination of the plasma membrane around an extracellular substance. Endocytic vesicles fuse with early endosomes to deliver the cargo for further sorting.
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0042599    lamellar body    A membrane-bounded organelle, specialized for the storage and secretion of various substances (surfactant phospholipids, glycoproteins and acid phosphates) which are arranged in the form of tightly packed, concentric, membrane sheets or lamellae. Has some similar properties to, but is distinct from, a lysosome.
    GO:0005764    lysosome    A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
    GO:0005578    proteinaceous extracellular matrix    A layer consisting mainly of proteins (especially collagen) and glycosaminoglycans (mostly as proteoglycans) that forms a sheet underlying or overlying cells such as endothelial and epithelial cells. The proteins are secreted by cells in the vicinity. An example of this component is found in Mus musculus.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GMH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:321 - Pro A:322   [ RasMol ]  
    Glu B:321 - Pro B:322   [ RasMol ]  
    Glu C:321 - Pro C:322   [ RasMol ]  
    Phe A:234 - Pro A:235   [ RasMol ]  
    Phe B:234 - Pro B:235   [ RasMol ]  
    Phe C:234 - Pro C:235   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2rib
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SFTPD_HUMAN | P35247
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SFTPD_HUMAN | P35247
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SFTPD_HUMAN | P352471b08 1m7l 1pw9 1pwb 2ggu 2ggx 2orj 2ork 2os9 2ria 2ric 2rid 2rie 3dbz 3g81 3g83 3g84 3ikn 3ikp 3ikq 3ikr 4e52 4m17 4m18

(-) Related Entries Specified in the PDB File

1pwb 1pwq 2ggu 2ggx 2orj 2ork 2ria 2ric 2rid 2rie