2REO - JenaLib

Title :   CRYSTAL STRUCTURE OF HUMAN SULFOTRANSFERASE 1C3 (SULT1C3) IN COMPLEX WITH PAP

Authors :   W. Tempel, P. Pan, A. Dong, P. Loppnau, C. H. Arrowsmith, A. M. Edwards, M. Sundstrom, J. Weigelt, A. Bochkarev, A. N. Plotnikov, Structural Consortium (Sgc)

Date :   26 Sep 07 (Deposition) - 09 Oct 07 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.65

Chains :   Asym./Biol. Unit : A

Keywords :   Sulfotransferase, Sulfate Conjugation, Pap, Structural Genomics Consortium, Sgc, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. Pan, W. Tempel, A. Dong, P. Loppnau, C. H. Arrowsmith, A. M. Edwards, M. Sundstrom, J. Weigelt, A. Bochkarev, A. N. Plotnikov
Crystal Structure Of Human Sulfotransferase 1C3 (Sult1C3) I Complex With Pap.
To Be Published
PubMed: search

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 3)

PROSITE Motifs (0, 0)

Exons (7, 7)

Asymmetric/Biological Unit (7, 7)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000329106	1	ENSE00001555501	chr2:108863651-108863822	172	ST1C3_HUMAN	1-58	58	1	A:42-58	17
1.2	ENST00000329106	2	ENSE00001323839	chr2:108868821-108868949	129	ST1C3_HUMAN	58-101	44	1	A:58-71	14
1.3	ENST00000329106	3	ENSE00001302138	chr2:108869801-108869898	98	ST1C3_HUMAN	101-133	33	1	A:112-133	22
1.4	ENST00000329106	4	ENSE00001292358	chr2:108872028-108872154	127	ST1C3_HUMAN	134-176	43	1	A:134-176	43
1.5	ENST00000329106	5	ENSE00001311706	chr2:108875190-108875284	95	ST1C3_HUMAN	176-207	32	1	A:176-207	32
1.8	ENST00000329106	8	ENSE00001312136	chr2:108881281-108881461	181	ST1C3_HUMAN	208-268	61	1	A:208-268	61
1.9	ENST00000329106	9	ENSE00001292700	chr2:108881695-108881807	113	ST1C3_HUMAN	268-304	37	1	A:268-304 (gaps)	37

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:222
 aligned with ST1C3_HUMAN | Q6IMI6 from UniProtKB/Swiss-Prot  Length:304

    Alignment length:263
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301   
          ST1C3_HUMAN    42 FQAKPDDLILATYPKSGTTWMHEILDMILNDGDVEKCKRAQTLDRHAFLELKFPHKEKPDLEFVLEMSSPQLIKTHLPSHLIPPSIWKENCKIVYVARNPKDCLVSYYHFHRMASFMPDPQNLEEFYEKFMSGKVVGGSWFDHVKGWWAAKDMHRILYLFYEDIKKDPKREIEKILKFLEKDISEEILNKIIYHTSFDVMKQNPMTNYTTLPTSIMDHSISPFMRKGMPGDWKNYFTVAQNEEFDKDYQKKMAGSTLTFRTEI 304
               SCOP domains d2reoa_ A: automated matches                                                                                                                                                                                                                                            SCOP domains
               CATH domains ------2reoA01 A:48-294 P-loop                                         containing nucleotide triphosphate hydrolases                                                                                                                                           --------- CATH domains
               Pfam domains ----Sulfotransfer_1-2reoA01 A:                                        46-297                                                                                                                                                                                    ------- Pfam domains
         Sec.struct. author .......eeeee....hhhhhhhhhhhhhh----------------------------------------.eeee..hhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh.....hhhhhhhhhhhhh....eeeeehhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh...........................hhhhhh.hhhhhhhhhhhhhhhh.-......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------C------------------------------R--------------T-------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1         ------------------------------------------Exon 1.3  PDB: A:112-133         Exon 1.4  PDB: A:134-176 UniProt: 134-176  -------------------------------Exon 1.8  PDB: A:208-268 UniProt: 208-268                    ------------------------------------ Transcript 1 (1)
           Transcript 1 (2) ----------------Exon 1.2  PDB: A:58-71 UniProt: 58-101      --------------------------------------------------------------------------Exon 1.5  PDB: A:176-207        ------------------------------------------------------------Exon 1.9  PDB: A:268-304 (gaps)       Transcript 1 (2)
                 2reo A  42 FQAKPDDLILATYPKSGTTWMHEILDMILN----------------------------------------QLIKTHLPSHLIPPSIWKENCKIVYVARNPKDCLVSYYHFHRMASFMPDPQNLEEFYEKFMSGKVVGGSWFDHVKGWWAAKDMHRILYLFYEDIKKDPKREIEKILKFLEKDISEEILNKIIYHTSFDVMKQNPMTNYTTLPTSIMDHSISPFMRKGMPGDWKNYFTVAQNEEFDKDYQKKMA-STLTFRTEI 304
                                    51        61        71         -         -         -         -|      121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291  | |  301   
                                                        71                                      112                                                                                                                                                                                   294 |        
                                                                                                                                                                                                                                                                                        296

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (ST1C3_HUMAN | Q6IMI6)

molecular function
	GO:0004027	alcohol sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + an alcohol = adenosine 3',5'-bisphosphate + an alkyl sulfate.
	GO:0004062	aryl sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate.
	GO:0008146	sulfotransferase activity	Catalysis of the transfer of a sulfate group from 3'-phosphoadenosine 5'-phosphosulfate to the hydroxyl group of an acceptor, producing the sulfated derivative and 3'-phosphoadenosine 5'-phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0006790	sulfur compound metabolic process	The chemical reactions and pathways involving the nonmetallic element sulfur or compounds that contain sulfur, such as the amino acids methionine and cysteine or the tripeptide glutathione.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		A3P	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2reo)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2reo
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ST1C3_HUMAN \| Q6IMI6
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.8.2.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description