|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 9)| Asymmetric Unit (4, 9) Biological Unit 1 (3, 16) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2RDP) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2RDP) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2RDP) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2RDP) |
Exons (0, 0)| (no "Exon" information available for 2RDP) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:140 aligned with D0VWY6_GEOSE | D0VWY6 from UniProtKB/TrEMBL Length:150 Alignment length:143 16 26 36 46 56 66 76 86 96 106 116 126 136 146 D0VWY6_GEOSE 7 AMNERTVAELEKLLRYIAANLKQRGREILTNYPITPPQFVALQWLLEEGDLTVGELSNKMYLACSTTTDLVDRMERNGLVARVRDEHDRRVVRIRLLEKGERIIEEVIEKRQRDLANVLESFSDEEIVVFERCLRKLHQEMTK 149 SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains 2rdpA00 A:4-146 'winged helix' repressor DNA binding domain CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2rdp A 4 AmNERTVAELEKLLRYIAANLKQRGREILTNYPITPPQFVALQWLLEEGDLTVGELSNKmYLACSTTTDLVDRmERNGLVARVRDEH---VVRIRLLEKGERIIEEVIEKRQRDLANVLESFSDEEIVVFERCLRKLHQEmTK 146 | 13 23 33 43 53 63 73 | 83 | -| 103 113 123 133 143| | 63-MSE 77-MSE 90 94 144-MSE 5-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2RDP) |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2RDP) |
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A (D0VWY6_GEOSE | D0VWY6)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|