|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (7, 7)| Asymmetric/Biological Unit (7, 7) |
Sites (7, 7)
Asymmetric Unit (7, 7)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2R61) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2R61) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2R61) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2R61) |
Exons (0, 0)| (no "Exon" information available for 2R61) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:195 aligned with Q9ZFS6_STAAU | Q9ZFS6 from UniProtKB/TrEMBL Length:234 Alignment length:197 47 57 67 77 87 97 107 117 127 137 147 157 167 177 187 197 207 217 227 Q9ZFS6_STAAU 38 ENVTKDIFDLRDYYSRASKELKNVTGYRYSKGGKHYLIFDKNRKFTRIQIFGKDIERIKKRKNPGLDIFVVKEAENRNGTVYSYGGVTKKNQGAYYDYLSAPRFVIKKEVGAGVSVHVKRYYIYKEEISLKELDFKLRQYLIQDFDLYKKFPKASKIKVTMKDGGYYTFELNKKLQTNRMSDVIDGRNIEKIEANIR 234 SCOP domains d2r61a1 A:8-100 Superantigen-like protein SET3 d2r61a2 A:101-204 Superantigen-like protein SET3 SCOP domains CATH domains 2r61A01 2r61A02 A:23-97 [code=2.40.50.110, no name defined] 2r61A01 A:8-22,A:98-204 [code=3.10.20.120, no name defined] CATH domains Pfam domains -------DUF1954-2r61A02 A:15-98 ------------Stap_Strp_tox_C-2r61A01 A:111-204 Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2r61 A 8 ENVTKDIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDAHQAFTRIQIFGKDIERLKARKNPGLDIFVVKEAENR--TVFSYGGVTKKNQGAYYDYLNAPKFVIKKEVDAGVYTHVKRHYIYKEEVSLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQPHRMSDVIDGRNIEKMEANIR 204 17 27 37 47 57 67 77 | 87 97 107 117 127 137 147 157 167 177 187 197 84 87
|
||||||||||||||||||||
SCOP Domains (2, 2)| Asymmetric/Biological Unit |
CATH Domains (2, 2)
Asymmetric/Biological Unit
|
Pfam Domains (2, 2)
Asymmetric/Biological Unit
|
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q9ZFS6_STAAU | Q9ZFS6)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|