2QP3 - JenaLib

Title :   IDENTIFICATION AND CHARACTERIZATION OF TWO AMINO ACIDS CRITICAL FOR THE SUBSTRATE INHIBITION OF SULT2A1

Authors :   Y. C. Hsieh

Date :   23 Jul 07 (Deposition) - 29 Jul 08 (Release) - 03 Jul 13 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.60

Chains :   Asym./Biol. Unit : A

Keywords :   Dehydroepiandrosterone(Dhea), Androsterone(Adt), Substrate Inhibition, Sulfotransferase, Substrate Binding Orientation, Bile Acid Catabolism, Lipid Metabolism, Steroid Metabolism, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   L. Y. Lu, Y. C. Hsieh, M. Y. Liu, Y. H. Lin, C. J. Chen, Y. S. Yang
Identification And Characterization Of Two Amino Acids Critical For The Substrate Inhibition Of Human Dehydroepiandrosterone Sulfotransferase (Sult2A1)
Mol. Pharmacol. V. 73 660 2008
PubMed-ID: 18042734 | Reference-DOI: 10.1124/MOL.107.041038

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 2)

PROSITE Motifs (0, 0)

Exons (6, 6)

Asymmetric/Biological Unit (6, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000222002	1	ENSE00001321232	chr19:48389654-48389379	276	ST2A1_HUMAN	1-46	46	1	A:2-46	45
1.2	ENST00000222002	2	ENSE00000715991	chr19:48387042-48386834	209	ST2A1_HUMAN	46-115	70	1	A:46-115	70
1.3	ENST00000222002	3	ENSE00000715969	chr19:48385467-48385341	127	ST2A1_HUMAN	116-158	43	1	A:116-158	43
1.4	ENST00000222002	4	ENSE00000715962	chr19:48382387-48382293	95	ST2A1_HUMAN	158-189	32	1	A:158-189	32
1.5	ENST00000222002	5	ENSE00000715952	chr19:48378091-48377914	178	ST2A1_HUMAN	190-249	60	1	A:190-245 (gaps)	56
1.6	ENST00000222002	6	ENSE00001310164	chr19:48374824-48373723	1102	ST2A1_HUMAN	249-285	37	1	A:251-285	35

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:267
 aligned with ST2A1_HUMAN | Q06520 from UniProtKB/Swiss-Prot  Length:285

    Alignment length:284
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281    
          ST2A1_HUMAN     2 SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE 285
               SCOP domains d2qp3a_ A: Hydroxysteroid sulfotransferase sult2a1                                                                                                                                                                                                                                           SCOP domains
               CATH domains 2qp3A00 A:2-285 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                         CATH domains
               Pfam domains --------------------------------Sulfotransfer_1-2qp3A01 A:34-278                                                                                                                                                                                                                     ------- Pfam domains
         Sec.struct. author ....eee..eee.....hhhhhhhhhhh.......eeee.....hhhhhhhhhhhhhh...hhhhhhhhhhhhh....hhhhhhhhhh.....eeee..hhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhh.........hhhhhhhhhhhh.....hhhhhhhhhhhhh....eeeeehhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh.------------........-----..hhhhh.hhhhhhhhhhhhhhhhh..hhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------P-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T------------------------ SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: A:2-46 UniProt: 1-46          ---------------------------------------------------------------------Exon 1.3  PDB: A:116-158 UniProt: 116-158  -------------------------------Exon 1.5  PDB: A:190-245 (gaps) UniProt: 190-249            ------------------------------------ Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------Exon 1.2  PDB: A:46-115 UniProt: 46-115                               ------------------------------------------Exon 1.4  PDB: A:158-189        -----------------------------------------------------------Exon 1.6  PDB: A:251-285 [INCOMPLETE] Transcript 1 (2)
                 2qp3 A   2 SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNIKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKE------------YVVDKTQL-----SGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE 285
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221   |     -      |241   |   251       261       271       281    
                                                                                                                                                                                                                                                         225          238    245   251

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (16, 16)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (ST2A1_HUMAN | Q06520)

molecular function
	GO:0004062	aryl sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate.
	GO:0047704	bile-salt sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + taurolithocholate = adenosine 3',5'-bisphosphate + taurolithocholate sulfate.
	GO:0004304	estrone sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + estrone = adenosine 3',5'-bisphosphate + estrone 3-sulfate.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0050294	steroid sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + a phenolic steroid = adenosine 3',5'-bisphosphate + steroid O-sulfate.
	GO:0008146	sulfotransferase activity	Catalysis of the transfer of a sulfate group from 3'-phosphoadenosine 5'-phosphosulfate to the hydroxyl group of an acceptor, producing the sulfated derivative and 3'-phosphoadenosine 5'-phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	The chemical reactions and pathways involving 3'-phosphoadenosine 5'-phosphosulfate, a naturally occurring mixed anhydride. It is an intermediate in the formation of a variety of sulfo compounds in biological systems.
	GO:0030573	bile acid catabolic process	The chemical reactions and pathways resulting in the breakdown of bile acids, any of a group of steroid carboxylic acids occurring in bile.
	GO:0007586	digestion	The whole of the physical, chemical, and biochemical processes carried out by multicellular organisms to break down ingested nutrients into components that may be easily absorbed and directed into metabolism.
	GO:0016042	lipid catabolic process	The chemical reactions and pathways resulting in the breakdown of lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0008202	steroid metabolic process	The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
	GO:0051923	sulfation	The addition of a sulfate group to a molecule.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		AOX	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ser A:92 - Pro A:93	[ RasMol ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2qp3
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ST2A1_HUMAN \| Q06520
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.8.2.14
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description