Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A PROTEIN OF UNKNOWN FUNCTION VPA0982 FROM VIBRIO PARAHAEMOLYTICUS RIMD 2210633
 
Authors :  K. Tan, E. Duggan, S. Moy, A. Joachimiak, Midwest Center For Structu Genomics (Mcsg)
Date :  05 Jul 07  (Deposition) - 24 Jul 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.48
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Apc85975, Vpa0982, Vibrio Parahaemolyticus Rimd 2210633, Structural Genomics, Psi-2, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Tan, E. Duggan, S. Moy, A. Joachimiak
The Crystal Structure Of A Protein Of Unknown Function, Vpa0982 From Vibrio Parahaemolyticus Rimd 2210633.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PROTEIN OF UNKNOWN FUNCTION VPA0982
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21
    Expression System PlasmidPMCSG19
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    GeneVPA0982
    Organism ScientificVIBRIO PARAHAEMOLYTICUS
    Organism Taxid223926
    StrainRIMD 2210633

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 8)

Asymmetric Unit (2, 8)
No.NameCountTypeFull Name
1EDO6Ligand/Ion1,2-ETHANEDIOL
2MSE2Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (2, 16)
No.NameCountTypeFull Name
1EDO12Ligand/Ion1,2-ETHANEDIOL
2MSE4Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:37 , LYS A:77 , PRO A:78 , TYR A:79 , ILE A:80 , HOH A:383 , HOH A:478BINDING SITE FOR RESIDUE EDO A 301
2AC2SOFTWARELYS A:8 , VAL A:106 , ASP A:107 , GLN A:127 , LYS A:131 , HOH A:321 , HOH A:346BINDING SITE FOR RESIDUE EDO A 302
3AC3SOFTWAREGLU A:101 , ARG A:124 , GLN A:127 , ARG A:128 , HOH A:346 , HOH A:398BINDING SITE FOR RESIDUE EDO A 303
4AC4SOFTWAREGLU A:123 , HOH A:335 , HOH A:396BINDING SITE FOR RESIDUE EDO A 304
5AC5SOFTWARETYR A:79 , GLN A:81 , ARG A:82 , LYS A:88 , HOH A:370 , HOH A:457BINDING SITE FOR RESIDUE EDO A 305
6AC6SOFTWARELEU A:76 , PRO A:78 , ASP A:159 , HOH A:329 , HOH A:369 , HOH A:431BINDING SITE FOR RESIDUE EDO A 306

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2QIP)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2QIP)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2QIP)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2QIP)

(-) Exons   (0, 0)

(no "Exon" information available for 2QIP)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:162
 aligned with Q9AF14_VIBPH | Q9AF14 from UniProtKB/TrEMBL  Length:162

    Alignment length:162
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160  
         Q9AF14_VIBPH     1 MQSDHKEKIAILVDVQNVYYTCREAYRSNFDYNQFWYVATQEKEVVSAKAYAIASNDPKQRQFHHILRGVGFEVMLKPYIQRRDGSAKGDWDVGITLDAIEIAPDVDRVILVSGDGDFSLLVERIQQRYNKKVTVYGVPRLTSQTLIDCADNFVAIDDDFLL 162
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains -2qipA00 A:2-162 5'-nuclease                                                                                                                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......eeeeeeeehhhhhhhhhhhhh...hhhhhhhhhh..eeeeeeeeee....hhhhhhhhhhhhhhh.eeee..............hhhhhhhhhhhhhhhh.eeeee..hhhhhhhhhhhhhhhh.eeeeeehhhhhhhhhhhhh.eeee.hhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2qip A   1 mQSDHKEKIAILVDVQNVYYTCREAYRSNFDYNQFWYVATQEKEVVSAKAYAIASNDPKQRQFHHILRGVGFEVmLKPYIQRRDGSAKGDWDVGITLDAIEIAPDVDRVILVSGDGDFSLLVERIQQRYNKKVTVYGVPRLTSQTLIDCADNFVAIDDDFLL 162
                            |       10        20        30        40        50        60        70    |   80        90       100       110       120       130       140       150       160  
                            |                                                                        75-MSE                                                                                   
                            1-MSE                                                                                                                                                             

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2QIP)

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2QIP)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2QIP)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2qip)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2qip
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9AF14_VIBPH | Q9AF14
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q9AF14_VIBPH | Q9AF14
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2QIP)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2QIP)