Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE F1-ATPASE FROM THE THERMOALKALIPHILIC BACTERIUM BACILLUS SP. TA2.A1
 
Authors :  A. Stocker, S. Keis, J. Vonck, G. M. Cook, P. Dimroth
Date :  25 Jun 07  (Deposition) - 21 Aug 07  (Release) - 08 May 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.06
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H
Keywords :  Blockage Of Atp Hydrolysis, F1-Atpase, Atp Synthase, Single Particle Analysis, Thermoalkaliphilic, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Stocker, S. Keis, J. Vonck, G. M. Cook, P. Dimroth
The Structural Basis For Unidirectional Rotation Of Thermoalkaliphilic F(1)-Atpase.
Structure V. 15 904 2007
PubMed-ID: 17697996  |  Reference-DOI: 10.1016/J.STR.2007.06.009

(-) Compounds

Molecule 1 - ATP SYNTHASE SUBUNIT ALPHA
    Chains: A, B, C
    EC Number: 3.6.1.34
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PTRC99A
    Expression System Strain: RNE41(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: ATPA
    Organism Scientific: BACILLUS SP.
    Organism Taxid: 90973
    Strain: TA2.A1
 
Molecule 2 - ATP SYNTHASE SUBUNIT BETA
    Chains: D, E, F
    EC Number: 3.6.1.34
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PTRC99A
    Expression System Strain: RNE41(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: ATPD
    Organism Scientific: BACILLUS SP.
    Organism Taxid: 90973
    Strain: TA2.A1
 
Molecule 3 - ATP SYNTHASE SUBUNIT GAMMA
    Chains: G
    EC Number: 3.6.1.34
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PTRC99A
    Expression System Strain: RNE41(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: ATPG
    Organism Scientific: BACILLUS SP.
    Organism Taxid: 90973
    Strain: TA2.A1
 
Molecule 4 - ATP SYNTHASE SUBUNIT EPSILON
    Chains: H
    EC Number: 3.6.1.34
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PTRC99A
    Expression System Strain: RNE41(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: ATPC
    Organism Scientific: BACILLUS SP.
    Organism Taxid: 90973
    Strain: TA2.A1

 Structural Features

(-) Chains, Units

  12345678
Asymmetric/Biological Unit : ABCDEFGH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2QE7)

(-) Sites  (0, 0)

(no "Site" information available for 2QE7)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2QE7)

(-) Cis Peptide Bonds  (16, 16)

Asymmetric/Biological Unit
No.Residues
1Arg A:354 -Pro A:355
2Arg B:354 -Pro B:355
3Arg C:354 -Pro C:355
4Arg D:34 -Pro D:35
5Met D:264 -Pro D:265
6Met D:416 -Pro D:417
7Arg E:34 -Pro E:35
8Met E:264 -Pro E:265
9Met E:416 -Pro E:417
10Arg F:34 -Pro F:35
11Met F:264 -Pro F:265
12Met F:416 -Pro F:417
13Pro G:72 -Val G:73
14Tyr G:131 -Pro G:132
15Thr G:143 -Pro G:144
16Asp G:162 -Glu G:163

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2QE7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2QE7)

(-) Exons   (0, 0)

(no "Exon" information available for 2QE7)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:474
 aligned with Q71CG5_9BACI | Q71CG5 from UniProtKB/TrEMBL  Length:502

    Alignment length:474
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496    
         Q71CG5_9BACI    27 EVGTVIQVGDGIARVHGLEKVMAGELLEFENGVMGMAQNLEEDNVGVVILGPYTEIREGTQVKRTGRIMEVPVGEALLGRVVNPLGQPLDGRGPIETAEYRPIESPAPGVMDRKSVHEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTTIAIDTIINQKGQDVICIYVAIGQKQSTVAGVVETLRQHDALDYTIVVTASASEPAPLLYLAPYAGCAMGEYFMYKGKHALVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDEKGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLESDLFYSGVRPAVNVGISVSRVGGAAQIKAMKKVAGTLRLDLAQYRELQAFAQFGSDLDKATQAKLNRGERTVEILKQDEHKPMPVEEQVISIYAVTNGFMDDIPVEDVRRFEEELLSFMRANKDSLLDHIRQTGELPDTKELDAAIEEFKKGFTP 500
               SCOP domains d2qe7a1 A:27-94 automated matches                                   d2qe7a2 A:95-371 automated matches                                                                                                                                                                                                                                                   d2qe7a3 A:372-500 automated matches                                                                                               SCOP domains
               CATH domains 2qe7A01 A:27-93  [code=2.40.30.20, no name defined]                2qe7A02 A:94-371 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                 2qe7A03 A:372-497  [code=1.20.150.20, no name defined]                                                                        --- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeeee..eeeee........eeeee....eeeeeeee..eeeeee...........eeeeeeee.eee.hhhhh..ee.................eee.....................hhhhhhh.........eeeee...hhhhhhhhhhhhhhh..eeeeeeee..hhhhhhhhhhhhhhh.....eeeeee....hhhhhhhhhhhhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhh.............hhhhhhhhhhh............eeeeeeeeee......hhhhhhhhh...eeeeehhhhhh............ee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhh.......hhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2qe7 A  27 EVGTVIQVGDGIARVHGLEKVMAGELLEFENGVMGMAQNLEEDNVGVVILGPYTEIREGTQVKRTGRIMEVPVGEALLGRVVNPLGQPLDGRGPIETAEYRPIESPAPGVMDRKSVHEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTTIAIDTIINQKGQDVICIYVAIGQKQSTVAGVVETLRQHDALDYTIVVTASASEPAPLLYLAPYAGCAMGEYFMYKGKHALVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDEKGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLESDLFYSGVRPAVNVGISVSRVGGAAQIKAMKKVAGTLRLDLAQYRELQAFAQFGSDLDKATQAKLNRGERTVEILKQDEHKPMPVEEQVISIYAVTNGFMDDIPVEDVRRFEEELLSFMRANKDSLLDHIRQTGELPDTKELDAAIEEFKKGFTP 500
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496    


Chain B from PDB  Type:PROTEIN  Length:474
 aligned with Q71CG5_9BACI | Q71CG5 from UniProtKB/TrEMBL  Length:502

    Alignment length:474
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496    
         Q71CG5_9BACI    27 EVGTVIQVGDGIARVHGLEKVMAGELLEFENGVMGMAQNLEEDNVGVVILGPYTEIREGTQVKRTGRIMEVPVGEALLGRVVNPLGQPLDGRGPIETAEYRPIESPAPGVMDRKSVHEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTTIAIDTIINQKGQDVICIYVAIGQKQSTVAGVVETLRQHDALDYTIVVTASASEPAPLLYLAPYAGCAMGEYFMYKGKHALVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDEKGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLESDLFYSGVRPAVNVGISVSRVGGAAQIKAMKKVAGTLRLDLAQYRELQAFAQFGSDLDKATQAKLNRGERTVEILKQDEHKPMPVEEQVISIYAVTNGFMDDIPVEDVRRFEEELLSFMRANKDSLLDHIRQTGELPDTKELDAAIEEFKKGFTP 500
               SCOP domains d2qe7b1 B:27-94 automated matches                                   d2qe7b2 B:95-371 automated matches                                                                                                                                                                                                                                                   d2qe7b3 B:372-500 automated matches                                                                                               SCOP domains
               CATH domains 2qe7B01 B:27-93  [code=2.40.30.20, no name defined]                2qe7B02 B:94-371 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                 2qe7B03 B:372-497  [code=1.20.150.20, no name defined]                                                                        --- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeeee..eeeee........eeeee....eeeeeeee..eeeeee...........eeeeeeee.eee........ee.................eee.....................hhhhhhh.........eeeee...hhhhhhhhhhhhhhh..eeeeeeee..hhhhhhhhhhhhhhh.....eeeeee....hhhhhhhhhhhhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhh.............hhhhhhhhhhh.....hhhhh..eeeeeeeeee......hhhhhhhhh...eeeeehhhhhh............ee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhh.......hhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2qe7 B  27 EVGTVIQVGDGIARVHGLEKVMAGELLEFENGVMGMAQNLEEDNVGVVILGPYTEIREGTQVKRTGRIMEVPVGEALLGRVVNPLGQPLDGRGPIETAEYRPIESPAPGVMDRKSVHEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTTIAIDTIINQKGQDVICIYVAIGQKQSTVAGVVETLRQHDALDYTIVVTASASEPAPLLYLAPYAGCAMGEYFMYKGKHALVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDEKGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLESDLFYSGVRPAVNVGISVSRVGGAAQIKAMKKVAGTLRLDLAQYRELQAFAQFGSDLDKATQAKLNRGERTVEILKQDEHKPMPVEEQVISIYAVTNGFMDDIPVEDVRRFEEELLSFMRANKDSLLDHIRQTGELPDTKELDAAIEEFKKGFTP 500
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496    


Chain C from PDB  Type:PROTEIN  Length:474
 aligned with Q71CG5_9BACI | Q71CG5 from UniProtKB/TrEMBL  Length:502

    Alignment length:474
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496    
         Q71CG5_9BACI    27 EVGTVIQVGDGIARVHGLEKVMAGELLEFENGVMGMAQNLEEDNVGVVILGPYTEIREGTQVKRTGRIMEVPVGEALLGRVVNPLGQPLDGRGPIETAEYRPIESPAPGVMDRKSVHEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTTIAIDTIINQKGQDVICIYVAIGQKQSTVAGVVETLRQHDALDYTIVVTASASEPAPLLYLAPYAGCAMGEYFMYKGKHALVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDEKGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLESDLFYSGVRPAVNVGISVSRVGGAAQIKAMKKVAGTLRLDLAQYRELQAFAQFGSDLDKATQAKLNRGERTVEILKQDEHKPMPVEEQVISIYAVTNGFMDDIPVEDVRRFEEELLSFMRANKDSLLDHIRQTGELPDTKELDAAIEEFKKGFTP 500
               SCOP domains d2qe7c1 C:27-94 automated matches                                   d2qe7c2 C:95-371 automated matches                                                                                                                                                                                                                                                   d2qe7c3 C:372-500 automated matches                                                                                               SCOP domains
               CATH domains 2qe7C01 C:27-93  [code=2.40.30.20, no name defined]                2qe7C02 C:94-371 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                 2qe7C03 C:372-497  [code=1.20.150.20, no name defined]                                                                        --- CATH domains
           Pfam domains (1) ATP-synt_ab_N-2qe7C01 C:27-92                                     -------------------------------------------------------ATP-synt_ab-2qe7C04 C:148-364                                                                                                                                                                                            -----------ATP-synt_ab_C-2qe7C07 C:376-480                                                                          -------------------- Pfam domains (1)
           Pfam domains (2) ATP-synt_ab_N-2qe7C02 C:27-92                                     -------------------------------------------------------ATP-synt_ab-2qe7C05 C:148-364                                                                                                                                                                                            -----------ATP-synt_ab_C-2qe7C08 C:376-480                                                                          -------------------- Pfam domains (2)
           Pfam domains (3) ATP-synt_ab_N-2qe7C03 C:27-92                                     -------------------------------------------------------ATP-synt_ab-2qe7C06 C:148-364                                                                                                                                                                                            -----------ATP-synt_ab_C-2qe7C09 C:376-480                                                                          -------------------- Pfam domains (3)
         Sec.struct. author .eeeeeeee..eeeee........eeeee....eeeeeeee..eeeeee...........eeeeeeee.eee.hhhhh..ee.................eee.....................hhhhhhh.........eeeee...hhhhhhhhhhhhhhh..eeeeeeee..hhhhhhhhhhhhhhh.....eeeeee....hhhhhhhhhhhhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhhhh...........hhhhhhhhhhh............eeeeeeeeee......hhhhhhhhh...eeeeehhhhhh............ee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhh.......hhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2qe7 C  27 EVGTVIQVGDGIARVHGLEKVMAGELLEFENGVMGMAQNLEEDNVGVVILGPYTEIREGTQVKRTGRIMEVPVGEALLGRVVNPLGQPLDGRGPIETAEYRPIESPAPGVMDRKSVHEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTTIAIDTIINQKGQDVICIYVAIGQKQSTVAGVVETLRQHDALDYTIVVTASASEPAPLLYLAPYAGCAMGEYFMYKGKHALVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDEKGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLESDLFYSGVRPAVNVGISVSRVGGAAQIKAMKKVAGTLRLDLAQYRELQAFAQFGSDLDKATQAKLNRGERTVEILKQDEHKPMPVEEQVISIYAVTNGFMDDIPVEDVRRFEEELLSFMRANKDSLLDHIRQTGELPDTKELDAAIEEFKKGFTP 500
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496    


Chain D from PDB  Type:PROTEIN  Length:461
 aligned with Q71CG3_9BACI | Q71CG3 from UniProtKB/TrEMBL  Length:462

    Alignment length:461
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461 
         Q71CG3_9BACI     2 NKGRIIQVMGPVVDIQFESGQLPDIYNAITIERPQGGTLTVEAAVHLGDNVVRCVAMASTDGLVRGLEAVDTGAPISVPVGKATLGRVFNVLGEPIDEQGEVNAEERHPIHRPAPEFEELSTADEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELINNVAQEHGGLSVFAGVGERTREGNDLYHEMKDSGVISKTSMVFGQMNEPPGARLRVALTGLTMAEYFRDREGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLAEMGIYPAVDPLASTSRILSPAVVGEEHYRVARGVQQVLQRYNDLQDIIAILGMDELSDEDKLIVARARKIQRFLSQPFHVAEQFTGMPGKYVPVKETVRGFKEILEGKHDNLPEEAFYMVGTIDEAVEKAKKL 462
               SCOP domains d2qe7d1 D:2-76 automated matches                                           d2qe7d2 D:77-349 automated matches                                                                                                                                                                                                                                               d2qe7d3 D:350-462 automated matches                                                                               SCOP domains
               CATH domains 2qe7D01 D:2-76  [code=2.40.10.170, no name defined]                        -2qe7D02 D:78-345 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                       -2qe7D03 D:347-462 Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3                         CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeee..eeeee..........eeeee.......eeeeeeeeee..eeeeee............eeeeeee.eee.hhhhh..ee.................eee......hhhhh.....ee...hhhhhhhh.ee...eeeee.....hhhhhhhhhhhhhhhhh...eeeee...hhhhhhhhhhhh...hhhh.eeeee.....hhhhhhhhhhhhhhhhhhhhhh.......eeehhhhhhhhhhhhhhhh...........hhhhhhhhhhh...........eeee.........hhhhhhhhh.eeeeee.hhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhh...hhhhh..........hhhhhhhhhhhhhhh.....hhhhh....hhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2qe7 D   2 NKGRIIQVMGPVVDIQFESGQLPDIYNAITIERPQGGTLTVEAAVHLGDNVVRCVAMASTDGLVRGLEAVDTGAPISVPVGKATLGRVFNVLGEPIDEQGEVNAEERHPIHRPAPEFEELSTADEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELINNVAQEHGGLSVFAGVGERTREGNDLYHEMKDSGVISKTSMVFGQMNEPPGARLRVALTGLTMAEYFRDREGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLAEMGIYPAVDPLASTSRILSPAVVGEEHYRVARGVQQVLQRYNDLQDIIAILGMDELSDEDKLIVARARKIQRFLSQPFHVAEQFTGMPGKYVPVKETVRGFKEILEGKHDNLPEEAFYMVGTIDEAVEKAKKL 462
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461 


Chain E from PDB  Type:PROTEIN  Length:461
 aligned with Q71CG3_9BACI | Q71CG3 from UniProtKB/TrEMBL  Length:462

    Alignment length:461
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461 
         Q71CG3_9BACI     2 NKGRIIQVMGPVVDIQFESGQLPDIYNAITIERPQGGTLTVEAAVHLGDNVVRCVAMASTDGLVRGLEAVDTGAPISVPVGKATLGRVFNVLGEPIDEQGEVNAEERHPIHRPAPEFEELSTADEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELINNVAQEHGGLSVFAGVGERTREGNDLYHEMKDSGVISKTSMVFGQMNEPPGARLRVALTGLTMAEYFRDREGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLAEMGIYPAVDPLASTSRILSPAVVGEEHYRVARGVQQVLQRYNDLQDIIAILGMDELSDEDKLIVARARKIQRFLSQPFHVAEQFTGMPGKYVPVKETVRGFKEILEGKHDNLPEEAFYMVGTIDEAVEKAKKL 462
               SCOP domains d2qe7e1 E:2-76 automated matches                                           d2qe7e2 E:77-349 automated matches                                                                                                                                                                                                                                               d2qe7e3 E:350-462 automated matches                                                                               SCOP domains
               CATH domains 2qe7E01 E:2-76  [code=2.40.10.170, no name defined]                        -2qe7E02 E:78-345 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                       -2qe7E03 E:347-462 Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3                         CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeee..eeeee..........eeeee.......eeeeeeeeee..eeeeee.............eeeeee.eee.hhhhh..ee.................eee......hhhhh.....ee...hhhhhhhh.ee...eeeee.....hhhhhhhhhhhhhhhhh...eeeee...hhhhhhhhhhhh...hhhh.eeeee.....hhhhhhhhhhhhhhhhhhhhhh.......eeehhhhhhhhhhhhhhhh...........hhhhhhhhhhh...........eeee.........hhhhhhhhh.eeeeee.hhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhh...hhhhh..........hhhhhhhhhhhhhhh.....hhhhh.....hhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2qe7 E   2 NKGRIIQVMGPVVDIQFESGQLPDIYNAITIERPQGGTLTVEAAVHLGDNVVRCVAMASTDGLVRGLEAVDTGAPISVPVGKATLGRVFNVLGEPIDEQGEVNAEERHPIHRPAPEFEELSTADEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELINNVAQEHGGLSVFAGVGERTREGNDLYHEMKDSGVISKTSMVFGQMNEPPGARLRVALTGLTMAEYFRDREGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLAEMGIYPAVDPLASTSRILSPAVVGEEHYRVARGVQQVLQRYNDLQDIIAILGMDELSDEDKLIVARARKIQRFLSQPFHVAEQFTGMPGKYVPVKETVRGFKEILEGKHDNLPEEAFYMVGTIDEAVEKAKKL 462
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461 


Chain F from PDB  Type:PROTEIN  Length:461
 aligned with Q71CG3_9BACI | Q71CG3 from UniProtKB/TrEMBL  Length:462

    Alignment length:461
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461 
         Q71CG3_9BACI     2 NKGRIIQVMGPVVDIQFESGQLPDIYNAITIERPQGGTLTVEAAVHLGDNVVRCVAMASTDGLVRGLEAVDTGAPISVPVGKATLGRVFNVLGEPIDEQGEVNAEERHPIHRPAPEFEELSTADEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELINNVAQEHGGLSVFAGVGERTREGNDLYHEMKDSGVISKTSMVFGQMNEPPGARLRVALTGLTMAEYFRDREGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLAEMGIYPAVDPLASTSRILSPAVVGEEHYRVARGVQQVLQRYNDLQDIIAILGMDELSDEDKLIVARARKIQRFLSQPFHVAEQFTGMPGKYVPVKETVRGFKEILEGKHDNLPEEAFYMVGTIDEAVEKAKKL 462
               SCOP domains d2qe7f1 F:2-76 automated matches                                           d2qe7f2 F:77-349 automated matches                                                                                                                                                                                                                                               d2qe7f3 F:350-462 automated matches                                                                               SCOP domains
               CATH domains 2qe7F01 F:2-76  [code=2.40.10.170, no name defined]                        -2qe7F02 F:78-345 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                       -2qe7F03 F:347-462 Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3                         CATH domains
           Pfam domains (1) ----ATP-synt_ab_N-2qe7F01 F:6-74                                         -------------------------------------------------------ATP-synt_ab-2qe7F04 F:130-344                                                                                                                                                                                          ------------ATP-synt_ab_C-2qe7F07 F:357-462                                                                            Pfam domains (1)
           Pfam domains (2) ----ATP-synt_ab_N-2qe7F02 F:6-74                                         -------------------------------------------------------ATP-synt_ab-2qe7F05 F:130-344                                                                                                                                                                                          ------------ATP-synt_ab_C-2qe7F08 F:357-462                                                                            Pfam domains (2)
           Pfam domains (3) ----ATP-synt_ab_N-2qe7F03 F:6-74                                         -------------------------------------------------------ATP-synt_ab-2qe7F06 F:130-344                                                                                                                                                                                          ------------ATP-synt_ab_C-2qe7F09 F:357-462                                                                            Pfam domains (3)
         Sec.struct. author ....eeeee..eeeee..........eeeeee.....eeeeeeeeeee..eeeeee............eeeeeee.eee.hhhhh..ee.................eee......hhhhh.....ee...hhhhhhhh.ee...eeeee.....hhhhhhhhhhhhhhhhh...eeeee...hhhhhhhhhhhh...hhhh.eeeee.....hhhhhhhhhhhhhhhhhhhhhh.......eeehhhhhhhhhhhhhhhh...........hhhhhhhhhhh...........eeee.........hhhhhhhhh.eeeeee.hhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh...................hhhhhhhhhhhhhhh.....hhhhh....hhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2qe7 F   2 NKGRIIQVMGPVVDIQFESGQLPDIYNAITIERPQGGTLTVEAAVHLGDNVVRCVAMASTDGLVRGLEAVDTGAPISVPVGKATLGRVFNVLGEPIDEQGEVNAEERHPIHRPAPEFEELSTADEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLIQELINNVAQEHGGLSVFAGVGERTREGNDLYHEMKDSGVISKTSMVFGQMNEPPGARLRVALTGLTMAEYFRDREGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSITSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLAEMGIYPAVDPLASTSRILSPAVVGEEHYRVARGVQQVLQRYNDLQDIIAILGMDELSDEDKLIVARARKIQRFLSQPFHVAEQFTGMPGKYVPVKETVRGFKEILEGKHDNLPEEAFYMVGTIDEAVEKAKKL 462
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461 


Chain G from PDB  Type:PROTEIN  Length:227
 aligned with Q71CG4_9BACI | Q71CG4 from UniProtKB/TrEMBL  Length:286

    Alignment length:264
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262    
         Q71CG4_9BACI     3 GMREIKRRIRSVKNTRQITKAMKMVAAAKLRRAQETAENARPYADKIKEVISSIAAGTKDFSHPMLEARPVKKTGYMVITSDRGLAGPYNANILRLVSKTIEERHQSKDEYVIFAVGRKGRDFFKKRGYPVVEEVTGISDTPSLTEIQDIAQSAIGMFADETFDKLTIFYNEFVSPIVQRPVEKQLLPLTSEEVLDGPVSAYEYEPDSESVLEVLLPKYAETLIYSALLDAKASEFGARMTAMGNATDNATEMLETLTLQFNRA 266
               SCOP domains d2qe7g_ G: automated matches                                                                                                                                                                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ATP-synt-2qe7G01 G:3-266                                                                                                                                                                                                                                                 Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhh.................--------------................ee.......hhhhhhhhhhhhh...............eehhhhhhhhhh....................hhhhhhhhhhhhh................................-----------------------......hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2qe7 G   3 GMREIKRRIRSVKNTRQITKAMKMVAAAKLRRAQETAENARPYADKI--------------SHPMLEARPVKKTGYMVITSDRGLAGPYNANILRLVSKTIEERHQSKDEYVIFAVGRKGRDFFKKRGYPVVEEVTGISDTPSLTEIQDIAQSAIGMFADETFDKLTIFYNEFVSPIVQRPVEKQLLPLTS-----------------------LLPKYAETLIYSALLDAKASEFGARMTAMGNATDNATEMLETLTLQFNRA 266
                                    12        22        32        42      |  -         - |      72        82        92       102       112       122       132       142       152       162       172       182       192|        -         -    |  222       232       242       252       262    
                                                                         49             64                                                                                                                              193                     217                                                 


Chain H from PDB  Type:PROTEIN  Length:135
 aligned with Q71CG2_9BACI | Q71CG2 from UniProtKB/TrEMBL  Length:135

    Alignment length:135
                                    10        20        30        40        50        60        70        80        90       100       110       120       130     
         Q71CG2_9BACI     1 MATVQVDIVTPERKVFQGEADIVIARGVEGELGVMAGHIPLVTPLKTAPVRIKQGDKETLIAVSGGFLEVRPDKVNILADTAELPEEIDVERAKKAKARHETILKRLDKTDKDYLRHKRALERAEVRLQVANSKS 135
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2qe7H01 H:1-88 ATP Synthase; domain 1                                                   2qe7H02 H:89-135                                CATH domains
               Pfam domains ---ATP-synt_DE_N-2qe7H02 H:4-82                                                   ---ATP-synt_DE-2qe7H01 H:86-134                     - Pfam domains
         Sec.struct. author ....eeee.......eee................................ee......ee.......eeee..eeee...........hhhhhhhhhhh....................hhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2qe7 H   1 MATVQVDIVTPERKVFQGEADIVIARGVEGELGVMAGHIPLVTPLKTAPVRIKQGDKETLIAVSGGFLEVRPDKVNILADTAELPEEIDVERAKKAKARHETILKRLDKTDKDYLRHKRALERAEVRLQVANSKS 135
                                    10        20        30        40        50        60        70        80        90       100       110       120       130
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (5, 19)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: All beta proteins (24004)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (7, 20)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Alpha (13335)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (6, 21)

Asymmetric/Biological Unit
(-)
Clan: HAS-barrel (27)
(-)
Clan: P-loop_NTPase (1112)
(-)
Clan: no clan defined [family: ATP-synt] (22)
(-)
Clan: no clan defined [family: ATP-synt_DE] (2)
(-)
Clan: no clan defined [family: ATP-synt_DE_N] (15)
(-)
Clan: no clan defined [family: ATP-synt_ab_C] (32)

(-) Gene Ontology  (18, 59)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C   (Q71CG5_9BACI | Q71CG5)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016820    hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances    Catalysis of the hydrolysis of an acid anhydride to directly drive the transport of a substance across a membrane.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0046933    proton-transporting ATP synthase activity, rotational mechanism    Catalysis of the transfer of protons from one side of a membrane to the other according to the reaction: ADP + H2O + phosphate + H+(in) = ATP + H+(out), by a rotational mechanism.
    GO:0046961    proton-transporting ATPase activity, rotational mechanism    Catalysis of the transfer of protons from one side of a membrane to the other according to the reaction: ATP + H2O + H+(in) = ADP + phosphate + H+(out), by a rotational mechanism.
biological process
    GO:0006754    ATP biosynthetic process    The chemical reactions and pathways resulting in the formation of ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0015991    ATP hydrolysis coupled proton transport    The transport of protons against an electrochemical gradient, using energy from ATP hydrolysis.
    GO:0046034    ATP metabolic process    The chemical reactions and pathways involving ATP, adenosine triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0015986    ATP synthesis coupled proton transport    The transport of protons across a membrane to generate an electrochemical gradient (proton-motive force) that powers ATP synthesis.
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0042777    plasma membrane ATP synthesis coupled proton transport    The transport of protons across the plasma membrane to generate an electrochemical gradient (proton-motive force) that powers ATP synthesis.
    GO:0015992    proton transport    The directed movement of protons (hydrogen ions) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0045261    proton-transporting ATP synthase complex, catalytic core F(1)    The sector of a hydrogen-transporting ATP synthase complex in which the catalytic activity resides; it comprises the catalytic core and central stalk, and is peripherally associated with a membrane, such as the plasma membrane or the mitochondrial inner membrane, when the entire ATP synthase is assembled.
    GO:0033178    proton-transporting two-sector ATPase complex, catalytic domain    A protein complex that forms part of a proton-transporting two-sector ATPase complex and catalyzes ATP hydrolysis or synthesis. The catalytic domain (F1, V1, or A1) comprises a hexameric catalytic core and a central stalk, and is peripherally associated with the membrane when the two-sector ATPase is assembled.

Chain D,E,F   (Q71CG3_9BACI | Q71CG3)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016820    hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances    Catalysis of the hydrolysis of an acid anhydride to directly drive the transport of a substance across a membrane.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0046933    proton-transporting ATP synthase activity, rotational mechanism    Catalysis of the transfer of protons from one side of a membrane to the other according to the reaction: ADP + H2O + phosphate + H+(in) = ATP + H+(out), by a rotational mechanism.
biological process
    GO:0006754    ATP biosynthetic process    The chemical reactions and pathways resulting in the formation of ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0015991    ATP hydrolysis coupled proton transport    The transport of protons against an electrochemical gradient, using energy from ATP hydrolysis.
    GO:0046034    ATP metabolic process    The chemical reactions and pathways involving ATP, adenosine triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0015986    ATP synthesis coupled proton transport    The transport of protons across a membrane to generate an electrochemical gradient (proton-motive force) that powers ATP synthesis.
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0042777    plasma membrane ATP synthesis coupled proton transport    The transport of protons across the plasma membrane to generate an electrochemical gradient (proton-motive force) that powers ATP synthesis.
    GO:0015992    proton transport    The directed movement of protons (hydrogen ions) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0045261    proton-transporting ATP synthase complex, catalytic core F(1)    The sector of a hydrogen-transporting ATP synthase complex in which the catalytic activity resides; it comprises the catalytic core and central stalk, and is peripherally associated with a membrane, such as the plasma membrane or the mitochondrial inner membrane, when the entire ATP synthase is assembled.
    GO:0033178    proton-transporting two-sector ATPase complex, catalytic domain    A protein complex that forms part of a proton-transporting two-sector ATPase complex and catalyzes ATP hydrolysis or synthesis. The catalytic domain (F1, V1, or A1) comprises a hexameric catalytic core and a central stalk, and is peripherally associated with the membrane when the two-sector ATPase is assembled.

Chain G   (Q71CG4_9BACI | Q71CG4)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0046933    proton-transporting ATP synthase activity, rotational mechanism    Catalysis of the transfer of protons from one side of a membrane to the other according to the reaction: ADP + H2O + phosphate + H+(in) = ATP + H+(out), by a rotational mechanism.
    GO:0046961    proton-transporting ATPase activity, rotational mechanism    Catalysis of the transfer of protons from one side of a membrane to the other according to the reaction: ATP + H2O + H+(in) = ADP + phosphate + H+(out), by a rotational mechanism.
biological process
    GO:0006754    ATP biosynthetic process    The chemical reactions and pathways resulting in the formation of ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0015986    ATP synthesis coupled proton transport    The transport of protons across a membrane to generate an electrochemical gradient (proton-motive force) that powers ATP synthesis.
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0042777    plasma membrane ATP synthesis coupled proton transport    The transport of protons across the plasma membrane to generate an electrochemical gradient (proton-motive force) that powers ATP synthesis.
    GO:0015992    proton transport    The directed movement of protons (hydrogen ions) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0045261    proton-transporting ATP synthase complex, catalytic core F(1)    The sector of a hydrogen-transporting ATP synthase complex in which the catalytic activity resides; it comprises the catalytic core and central stalk, and is peripherally associated with a membrane, such as the plasma membrane or the mitochondrial inner membrane, when the entire ATP synthase is assembled.

Chain H   (Q71CG2_9BACI | Q71CG2)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0046933    proton-transporting ATP synthase activity, rotational mechanism    Catalysis of the transfer of protons from one side of a membrane to the other according to the reaction: ADP + H2O + phosphate + H+(in) = ATP + H+(out), by a rotational mechanism.
    GO:0046961    proton-transporting ATPase activity, rotational mechanism    Catalysis of the transfer of protons from one side of a membrane to the other according to the reaction: ATP + H2O + H+(in) = ADP + phosphate + H+(out), by a rotational mechanism.
biological process
    GO:0006754    ATP biosynthetic process    The chemical reactions and pathways resulting in the formation of ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0015986    ATP synthesis coupled proton transport    The transport of protons across a membrane to generate an electrochemical gradient (proton-motive force) that powers ATP synthesis.
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0042777    plasma membrane ATP synthesis coupled proton transport    The transport of protons across the plasma membrane to generate an electrochemical gradient (proton-motive force) that powers ATP synthesis.
    GO:0015992    proton transport    The directed movement of protons (hydrogen ions) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0045261    proton-transporting ATP synthase complex, catalytic core F(1)    The sector of a hydrogen-transporting ATP synthase complex in which the catalytic activity resides; it comprises the catalytic core and central stalk, and is peripherally associated with a membrane, such as the plasma membrane or the mitochondrial inner membrane, when the entire ATP synthase is assembled.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2qe7)
 
  Sites
(no "Sites" information available for 2qe7)
 
  Cis Peptide Bonds
    Arg A:354 - Pro A:355   [ RasMol ]  
    Arg B:354 - Pro B:355   [ RasMol ]  
    Arg C:354 - Pro C:355   [ RasMol ]  
    Arg D:34 - Pro D:35   [ RasMol ]  
    Arg E:34 - Pro E:35   [ RasMol ]  
    Arg F:34 - Pro F:35   [ RasMol ]  
    Asp G:162 - Glu G:163   [ RasMol ]  
    Met D:264 - Pro D:265   [ RasMol ]  
    Met D:416 - Pro D:417   [ RasMol ]  
    Met E:264 - Pro E:265   [ RasMol ]  
    Met E:416 - Pro E:417   [ RasMol ]  
    Met F:264 - Pro F:265   [ RasMol ]  
    Met F:416 - Pro F:417   [ RasMol ]  
    Pro G:72 - Val G:73   [ RasMol ]  
    Thr G:143 - Pro G:144   [ RasMol ]  
    Tyr G:131 - Pro G:132   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2qe7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q71CG2_9BACI | Q71CG2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  Q71CG3_9BACI | Q71CG3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  Q71CG4_9BACI | Q71CG4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  Q71CG5_9BACI | Q71CG5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.6.1.34
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q71CG2_9BACI | Q71CG2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q71CG3_9BACI | Q71CG3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q71CG4_9BACI | Q71CG4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q71CG5_9BACI | Q71CG5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2QE7)

(-) Related Entries Specified in the PDB File

1jnv THE CONFORMATION OF THE EPSILON AND GAMMA SUBUNITS WITHIN THE E. COLI F1 ATPASE
1sky CRYSTAL STRUCTURE OF THE NUCLEOTIDE FREE ALPHA3BETA3 SUB- COMPLEX OF F1-ATPASE FROM THE THERMOPHILIC BACILLUS PS3