Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF STAPHYLOCOCCAL NUCLEASE VARIANT V66Y/P117G/H124L/S128A AT 100K
 
Authors :  J. L. Schlessman, C. Abe, E. B. Garcia-Moreno
Date :  10 May 07  (Deposition) - 22 Apr 08  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A
Keywords :  Staphylococcal Nuclease, Nuclease, Hyperstable Variant, Internal Waters, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. L. Schlessman, C. Abe, A. Gittis, D. A. Karp, M. A. Dolan, B. Garcia-Moreno E
Crystallographic Study Of Hydration Of An Internal Cavity In Engineered Proteins With Buried Polar Or Ionizable Groups.
Biophys. J. V. 94 3208 2008
PubMed-ID: 18178652  |  Reference-DOI: 10.1529/BIOPHYSJ.107.122473
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - THERMONUCLEASE
    Chains: A
    EC Number: 3.1.31.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: LAMBDA
    Expression System Strain: AR120
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: NUC
    Mutation: YES
    Organism Scientific: STAPHYLOCOCCUS AUREUS
    Organism Taxid: 1280
    Synonym: TNASE, MICROCOCCAL NUCLEASE, STAPHYLOCOCCAL NUCLEASE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2PW7)

(-) Sites  (0, 0)

(no "Site" information available for 2PW7)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2PW7)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2PW7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2PW7)

(-) PROSITE Motifs  (3, 3)

Asymmetric/Biological Unit (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TNASE_3PS50830 Thermonuclease domain profile.NUC_STAAW87-221  1A:8-141
2TNASE_1PS01123 Thermonuclease family signature 1.NUC_STAAW98-122  1A:19-43
3TNASE_2PS01284 Thermonuclease family signature 2.NUC_STAAW162-172  1A:83-93

(-) Exons   (0, 0)

(no "Exon" information available for 2PW7)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:130
 aligned with A5A513_STAAU | A5A513 from UniProtKB/TrEMBL  Length:215

    Alignment length:135
                                    84        94       104       114       124       134       144       154       164       174       184       194       204     
         A5A513_STAAU    75 LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWS 209
               SCOP domains d2pw7a_ A: Staphylococcal nuclease                                                                                                      SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------SNase-2pw7A01      A:33-141                                                                                   Pfam domains
         Sec.struct. author ..eeeeeeeee....eeeeee..eeeeeee..ee.....-----...hhhhhhhhhhhhhhhh..eeeee...........eeeeeee..eehhhhhhhh...ee.........hhhhhhhhhhhhhhh.hhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pw7 A   7 LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETK-----VEKYGPEASAFTKKMYENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS 141
                                    16        26        36        |-    |   56        66        76        86        96       106       116       126       136     
                                                                 45    51                                                                                          


Chain A from PDB  Type:PROTEIN  Length:130
 aligned with NUC_STAAW | Q8NXI6 from UniProtKB/Swiss-Prot  Length:228

    Alignment length:135
                                    95       105       115       125       135       145       155       165       175       185       195       205       215     
            NUC_STAAW    86 LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWS 220
               SCOP domains d2pw7a_ A: Staphylococcal nuclease                                                                                                      SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------SNase-2pw7A01      A:33-141                                                                                   Pfam domains
         Sec.struct. author ..eeeeeeeee....eeeeee..eeeeeee..ee.....-----...hhhhhhhhhhhhhhhh..eeeee...........eeeeeee..eehhhhhhhh...ee.........hhhhhhhhhhhhhhh.hhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -TNASE_3  PDB: A:8-141 UniProt: 87-221                                                                                                  PROSITE (1)
                PROSITE (2) ------------TNASE_1  PDB: A:19-43    ---------------------------------------TNASE_2    ------------------------------------------------ PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pw7 A   7 LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETK-----VEKYGPEASAFTKKMYENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS 141
                                    16        26        36        |-    |   56        66        76        86        96       106       116       126       136     
                                                                 45    51
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2PW7)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: SNase] (72)

(-) Gene Ontology  (7, 10)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (NUC_STAAW | Q8NXI6)
molecular function
    GO:0004519    endonuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids by creating internal breaks.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004518    nuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
biological process
    GO:0090305    nucleic acid phosphodiester bond hydrolysis    The nucleic acid metabolic process in which the phosphodiester bonds between nucleotides are cleaved by hydrolysis.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain A   (A5A513_STAAU | A5A513)
molecular function
    GO:0004518    nuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
biological process
    GO:0090305    nucleic acid phosphodiester bond hydrolysis    The nucleic acid metabolic process in which the phosphodiester bonds between nucleotides are cleaved by hydrolysis.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2pw7)
 
  Sites
(no "Sites" information available for 2pw7)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2pw7)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2pw7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A5A513_STAAU | A5A513
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  NUC_STAAW | Q8NXI6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.31.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A5A513_STAAU | A5A513
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  NUC_STAAW | Q8NXI6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NUC_STAAW | Q8NXI6: 2gsi 2lkv 2m00 2oxp 2pqe 2pw5 2pyk 2pzt 2pzu 2pzw 3d4w 3d8g 3mvv 3qoj 3qol 3qon 3r3o
UniProtKB/TrEMBL
        A5A513_STAAU | A5A513: 2f3w 2pyk 2pzw

(-) Related Entries Specified in the PDB File

1u9r 2pw5