|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 7)| Asymmetric/Biological Unit (3, 7) |
Sites (7, 7)
Asymmetric Unit (7, 7)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2PSU) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2PSU) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2PSU) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2PSU) |
Exons (0, 0)| (no "Exon" information available for 2PSU) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:99 aligned with O38723_9HIV1 | O38723 from UniProtKB/TrEMBL Length:99 Alignment length:99 10 20 30 40 50 60 70 80 90 O38723_9HIV1 1 PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 99 SCOP domains d2psua_ A: Human immunodeficiency virus type 1 protease SCOP domains CATH domains 2psuA00 A:1-99 Acid Proteases CATH domains Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------- Transcript 2psu A 1 PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 99 10 20 30 40 50 60 70 80 90 Chain A from PDB Type:PROTEIN Length:99 aligned with O38732_9HIV1 | O38732 from UniProtKB/TrEMBL Length:99 Alignment length:99 10 20 30 40 50 60 70 80 90 O38732_9HIV1 1 PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 99 SCOP domains d2psua_ A: Human immunodeficiency virus type 1 protease SCOP domains CATH domains 2psuA00 A:1-99 Acid Proteases CATH domains Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------- Transcript 2psu A 1 PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 99 10 20 30 40 50 60 70 80 90 Chain B from PDB Type:PROTEIN Length:99 aligned with O38723_9HIV1 | O38723 from UniProtKB/TrEMBL Length:99 Alignment length:99 10 20 30 40 50 60 70 80 90 O38723_9HIV1 1 PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 99 SCOP domains d2psub_ B: Human immunodeficiency virus type 1 protease SCOP domains CATH domains 2psuB00 B:1-99 Acid Proteases CATH domains Pfam domains (1) ---RVP-2psuB01 B:4-98 - Pfam domains (1) Pfam domains (2) ---RVP-2psuB02 B:4-98 - Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------- Transcript 2psu B 1 PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 99 10 20 30 40 50 60 70 80 90 Chain B from PDB Type:PROTEIN Length:99 aligned with O38732_9HIV1 | O38732 from UniProtKB/TrEMBL Length:99 Alignment length:99 10 20 30 40 50 60 70 80 90 O38732_9HIV1 1 PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 99 SCOP domains d2psub_ B: Human immunodeficiency virus type 1 protease SCOP domains CATH domains 2psuB00 B:1-99 Acid Proteases CATH domains Pfam domains (1) ---RVP-2psuB01 B:4-98 - Pfam domains (1) Pfam domains (2) ---RVP-2psuB02 B:4-98 - Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------- Transcript 2psu B 1 PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 99 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (1, 2)| Asymmetric/Biological Unit |
Gene Ontology (4, 8)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (O38732_9HIV1 | O38732)
Chain A,B (O38723_9HIV1 | O38723)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|