2PQT - JenaLib

Title :   HUMAN N-ACETYLTRANSFERASE 1

Authors :   W. Tempel, H. Wu, L. Dombrovski, P. Loppnau, J. Weigelt, M. Sundstrom, C. H. Arrowsmith, A. M. Edwards, D. M. Grant, A. Bochkarev, A. N. Plotnikov, Structural Genomics Consortium (Sgc)

Date :   02 May 07 (Deposition) - 15 May 07 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.78

Chains :   Asym./Biol. Unit : A

Keywords :   Arylamine N-Acetyltransferase 1, Arylamide Acetylase 1, Structural Genomics Consortium, Sgc, Bromoacetanilide, Covalent, Inhibitor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. Wu, L. Dombrovsky, W. Tempel, F. Martin, P. Loppnau, G. H. Goodfellow, D. M. Grant, A. N. Plotnikov
Structural Basis Of Substrate-Binding Specificity Of Human Arylamine N-Acetyltransferases.
J. Biol. Chem. V. 282 30189 2007
PubMed-ID: 17656365 | Reference-DOI: 10.1074/JBC.M704138200
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 4)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (10, 10)

Asymmetric/Biological Unit (10, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_004606	R	64	W	ARY1_HUMAN	Polymorphism	56379106	A	R	64	W
02	UniProt	VAR_009510	R	117	T	ARY1_HUMAN	Polymorphism	55641436	A	R	117	T
03	UniProt	VAR_004607	V	149	I	ARY1_HUMAN	Polymorphism	4987076	A	V	149	I
04	UniProt	VAR_009069	R	187	Q	ARY1_HUMAN	Polymorphism	4986782	A	R	187	Q
05	UniProt	VAR_009070	M	205	V	ARY1_HUMAN	Polymorphism	72554609	A	M	205	V
06	UniProt	VAR_020384	T	207	I	ARY1_HUMAN	Polymorphism	4987195	A	T	207	I
07	UniProt	VAR_009071	S	214	A	ARY1_HUMAN	Polymorphism	4986783	A	S	214	A
08	UniProt	VAR_009072	D	251	V	ARY1_HUMAN	Polymorphism	56172717	A	D	251	V
09	UniProt	VAR_009073	E	261	K	ARY1_HUMAN	Polymorphism	72554610	A	E	261	K
10	UniProt	VAR_009074	I	263	V	ARY1_HUMAN	Polymorphism	72554611	A	I	263	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (1, 1)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:295
 aligned with ARY1_HUMAN | P18440 from UniProtKB/Swiss-Prot  Length:290

    Alignment length:295
                                 1                                                                                                                                                                                                                                                                                                 
                                 |   5        15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285     
           ARY1_HUMAN     - -----MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI 290
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------Acetyltransf_2-2pqtA01 A:20-280                                                                                                                                                                                                                                      ---------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhh........hhhhhhhhhhhhhhhh.ee.hhhhhh.....hhhhhhhhhh......hhhhhhhhhhhhhhhhh.eeeeeeeeeee....ee.....eeeeeeee..eeeee....hhhhh....ee.....eee....eeeeeee..eeeeeee..eee..hhhhh.........eeeeeee.....hhhhhhhhhhhhhhh..hhhhhh.eeeee...eeeeee..eeeeeeeeee..eeeeeeee.hhhhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------W----------------------------------------------------T-------------------------------I-------------------------------------Q-----------------V-I------A------------------------------------V---------K-V--------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 -----Exon 1.9e  PDB: A:1-290 UniProt: 1-292 [INCOMPLETE]                                                                                                                                                                                                                                                Transcript 1
                 2pqt A  -4 GSGSGSDIEAYFERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWxLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI 290
                                     5        15        25        35        45        55        65  |     75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285     
                                                                                                   68-TYX

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (1, 1)

Gene Ontology (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (ARY1_HUMAN | P18440)

molecular function
	GO:0016407	acetyltransferase activity	Catalysis of the transfer of an acetyl group to an acceptor molecule.
	GO:0004060	arylamine N-acetyltransferase activity	Catalysis of the reaction: acetyl-CoA + an arylamine = CoA + an N-acetylarylamine.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016746	transferase activity, transferring acyl groups	Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0006805	xenobiotic metabolic process	The chemical reactions and pathways involving a xenobiotic compound, a compound foreign to living organisms. Used of chemical compounds, e.g. a xenobiotic chemical, such as a pesticide.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		TYX	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		UNX	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2pqt)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2pqt
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ARY1_HUMAN \| P18440
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.3.1.5
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description