Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A HTH XRE-FAMILY LIKE PROTEIN FROM AGROBACTERIUM TUMEFACIENS
 
Authors :  M. E. Cuff, T. Skarina, O. Onopriyenko, A. Edwards, A. Savchenko, A. Joa Midwest Center For Structural Genomics (Mcsg)
Date :  30 Apr 07  (Deposition) - 29 May 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (4x)
Biol. Unit 2:  A  (1x)
Keywords :  Agrobacterium Tumefaciens, Hth-Motif, Xre-Family, Structural Genomics, Psi-2, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. E. Cuff, T. Skarina, O. Onopriyenko, A. Edwards, A. Savchenko, A. Joachimiak
Structure Of A Hth Xre-Family Like Protein From Agrobacterium Tumefaciens.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - UNCHARACTERIZED PROTEIN ATU1735
    Atcc33970
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidMODIFIED P11
    Expression System StrainMODIFIED BL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneATU1735, AGR_C_3184
    Organism ScientificAGROBACTERIUM TUMEFACIENS STR.
    Organism Taxid176299
    StrainC58
    SynonymAGR_C_3184P

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (4x)A
Biological Unit 2 (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 9)

Asymmetric Unit (3, 9)
No.NameCountTypeFull Name
1GOL2Ligand/IonGLYCEROL
2MSE1Mod. Amino AcidSELENOMETHIONINE
3SO46Ligand/IonSULFATE ION
Biological Unit 1 (3, 36)
No.NameCountTypeFull Name
1GOL8Ligand/IonGLYCEROL
2MSE4Mod. Amino AcidSELENOMETHIONINE
3SO424Ligand/IonSULFATE ION
Biological Unit 2 (3, 9)
No.NameCountTypeFull Name
1GOL2Ligand/IonGLYCEROL
2MSE1Mod. Amino AcidSELENOMETHIONINE
3SO46Ligand/IonSULFATE ION

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:37 , ARG A:38 , LYS A:41 , HOH A:228 , HOH A:247BINDING SITE FOR RESIDUE SO4 A 101
2AC2SOFTWAREGLU A:45 , ARG A:59 , ARG A:65 , HOH A:205BINDING SITE FOR RESIDUE SO4 A 102
3AC3SOFTWARESER A:66 , GLU A:67 , ASP A:69 , ARG A:73 , HOH A:211 , HOH A:217 , HOH A:242BINDING SITE FOR RESIDUE SO4 A 103
4AC4SOFTWAREHIS A:52 , GLN A:70 , ARG A:73 , HOH A:215 , HOH A:257 , HOH A:260BINDING SITE FOR RESIDUE SO4 A 104
5AC5SOFTWARELYS A:34 , ARG A:38 , HOH A:252 , HOH A:261BINDING SITE FOR RESIDUE SO4 A 106
6AC6SOFTWAREARG A:50BINDING SITE FOR RESIDUE SO4 A 107
7AC7SOFTWAREARG A:50 , ARG A:91BINDING SITE FOR RESIDUE GOL A 201
8AC8SOFTWAREARG A:32 , HOH A:212 , HOH A:256 , HOH A:257 , HOH A:265 , HOH A:266BINDING SITE FOR RESIDUE GOL A 202

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2PPX)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2PPX)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2PPX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2PPX)

(-) Exons   (0, 0)

(no "Exon" information available for 2PPX)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:62
 aligned with A9CIQ1_AGRFC | A9CIQ1 from UniProtKB/TrEMBL  Length:95

    Alignment length:62
                                    39        49        59        69        79        89  
          A9CIQ1_AGRFC   30 MPRIKIIRRALKLTQEEFSARYHIPLGTLRDWEQGRSEPDQPARAYLKIIAVDPEGTAAALR 91
               SCOP domains d2ppxa1 A:30-91 Uncharacterized protein Atu1735                SCOP domains
               CATH domains -2ppxA00 A:31-91 lambda repressor-like DNA-binding domains     CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh..hhhhhhhhhh.hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                  2ppx A 30 mPRIKIIRRALKLTQEEFSARYHIPLGTLRDWEQGRSEPDQPARAYLKIIAVDPEGTAAALR 91
                            |       39        49        59        69        79        89  
                            |                                                             
                           30-MSE                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (1, 1)

Asymmetric Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2PPX)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A   (A9CIQ1_AGRFC | A9CIQ1)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ppx)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ppx
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A9CIQ1_AGRFC | A9CIQ1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A9CIQ1_AGRFC | A9CIQ1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2PPX)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2PPX)