|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 9)
Asymmetric Unit (3, 9)
|
Sites (8, 8)
Asymmetric Unit (8, 8)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2PPX) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2PPX) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2PPX) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2PPX) |
Exons (0, 0)| (no "Exon" information available for 2PPX) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:62 aligned with A9CIQ1_AGRFC | A9CIQ1 from UniProtKB/TrEMBL Length:95 Alignment length:62 39 49 59 69 79 89 A9CIQ1_AGRFC 30 MPRIKIIRRALKLTQEEFSARYHIPLGTLRDWEQGRSEPDQPARAYLKIIAVDPEGTAAALR 91 SCOP domains d2ppxa1 A:30-91 Uncharacterized protein Atu1735 SCOP domains CATH domains -2ppxA00 A:31-91 lambda repressor-like DNA-binding domains CATH domains Pfam domains -------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------- Transcript 2ppx A 30 mPRIKIIRRALKLTQEEFSARYHIPLGTLRDWEQGRSEPDQPARAYLKIIAVDPEGTAAALR 91 | 39 49 59 69 79 89 | 30-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2PPX) |
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A (A9CIQ1_AGRFC | A9CIQ1)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|