Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PROTEIN YMCA FROM BACILLUS SUBTILIS, NORTHEAST STRUCTURAL GENOMICS TARGET SR375
 
Authors :  J. Seetharaman, M. Abashidze, F. Forouhar, D. Wang, Y. Fang, K. Cunningham, L-C. Ma, R. Xia, J. Liu, M. C. Baran, T. B. Acton, B. Rost, G. T. Montelione, L. Tong, J. F. Hunt, Northeast Structural Genomics Consortium (Nesg)
Date :  13 Apr 07  (Deposition) - 01 May 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Ymca, Regulate Community Development, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Seetharaman, M. Abashidze, F. Forouhar, D. Wang, Y. Fang, K. Cunningham, L-C. Ma, R. Xia, J. Liu, M. C. Baran, T. B. Acton, B. Rost, G. T. Montelione, L. Tong, J. F. Hunt
Crystal Structure Of Protein Ymca From Bacillus Subtilis.
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN YMCA
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET21
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: YMCA, BSU17020
    Organism Scientific: BACILLUS SUBTILIS
    Organism Taxid: 1423
    Strain: 168

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric/Biological Unit (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2PIH)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2PIH)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2PIH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2PIH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2PIH)

(-) Exons   (0, 0)

(no "Exon" information available for 2PIH)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:123
 aligned with YMCA_BACSU | O31779 from UniProtKB/Swiss-Prot  Length:143

    Alignment length:123
                                    11        21        31        41        51        61        71        81        91       101       111       121   
           YMCA_BACSU     2 TLYSKKDIVQQARNLAKMISETEEVDFFKRAEAQINENDKVSTIVNQIKALQKQAVNLKHYEKHEALKQVEAKIDALQEELEEIPVIQEFRDSQMEVNDLLQLVAHTISNQVTNEIITSTGGD 124
               SCOP domains d2piha1 A:2-124 Uncharacterized protein YmcA                                                                                SCOP domains
               CATH domains 2pihA00 A:2-124 YheA/YmcA-like domains                                                                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pih A   2 TLYSKKDIVQQARNLAKmISETEEVDFFKRAEAQINENDKVSTIVNQIKALQKQAVNLKHYEKHEALKQVEAKIDALQEELEEIPVIQEFRDSQmEVNDLLQLVAHTISNQVTNEIITSTGGD 124
                                    11       |21        31        41        51        61        71        81        91    |  101       111       121   
                                            19-MSE                                                                       96-MSE                        


Chain B from PDB  Type:PROTEIN  Length:123
 aligned with YMCA_BACSU | O31779 from UniProtKB/Swiss-Prot  Length:143

    Alignment length:123
                                    11        21        31        41        51        61        71        81        91       101       111       121   
           YMCA_BACSU     2 TLYSKKDIVQQARNLAKMISETEEVDFFKRAEAQINENDKVSTIVNQIKALQKQAVNLKHYEKHEALKQVEAKIDALQEELEEIPVIQEFRDSQMEVNDLLQLVAHTISNQVTNEIITSTGGD 124
               SCOP domains d2pihb_ B: Uncharacterized protein YmcA                                                                                     SCOP domains
               CATH domains 2pihB00 B:2-124 YheA/YmcA-like domains                                                                                      CATH domains
           Pfam domains (1) ------DUF964-2pihB01 B:8-116                                                                                       -------- Pfam domains (1)
           Pfam domains (2) ------DUF964-2pihB02 B:8-116                                                                                       -------- Pfam domains (2)
         Sec.struct. author ...hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pih B   2 TLYSKKDIVQQARNLAKmISETEEVDFFKRAEAQINENDKVSTIVNQIKALQKQAVNLKHYEKHEALKQVEAKIDALQEELEEIPVIQEFRDSQmEVNDLLQLVAHTISNQVTNEIITSTGGD 124
                                    11       |21        31        41        51        61        71        81        91    |  101       111       121   
                                            19-MSE                                                                       96-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: DUF964] (3)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2PIH)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2pih)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2pih)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2pih
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  YMCA_BACSU | O31779
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  YMCA_BACSU | O31779
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2PIH)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2PIH)