|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (5, 15)
|
Asymmetric Unit (12, 12)
|
(no "SS Bond" information available for 2PG4) |
(no "Cis Peptide Bond" information available for 2PG4) |
(no "SAP(SNP)/Variant" information available for 2PG4) |
(no "PROSITE Motif" information available for 2PG4) |
(no "Exon" information available for 2PG4) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:92 aligned with Q9YDN4_AERPE | Q9YDN4 from UniProtKB/TrEMBL Length:94 Alignment length:92 10 20 30 40 50 60 70 80 90 Q9YDN4_AERPE 1 MDDETLRLQFGHLIRILPTLLEFEKKGYEPSLAEIVKASGVSEKTFFMGLKDRLIRAGLVKEETLSYRVKTLKLTEKGRRLAECLEKCRDVL 92 SCOP domains d2pg4a1 A:1-92 Uncharacterized protein APE0880.1 SCOP domains CATH domains -2pg4A00 A:2-92 'winged helix' repressor DNA binding domain CATH domains Pfam domains -------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------- Transcript 2pg4 A 1 mDDETLRLQFGHLIRILPTLLEFEKKGYEPSLAEIVKASGVSEKTFFmGLKDRLIRAGLVKEETLSYRVKTLKLTEKGRRLAECLEKCRDVL 92 | 10 20 30 40 |50 60 70 80 90 | 48-MSE 1-MSE Chain B from PDB Type:PROTEIN Length:91 aligned with Q9YDN4_AERPE | Q9YDN4 from UniProtKB/TrEMBL Length:94 Alignment length:91 12 22 32 42 52 62 72 82 92 Q9YDN4_AERPE 3 DETLRLQFGHLIRILPTLLEFEKKGYEPSLAEIVKASGVSEKTFFMGLKDRLIRAGLVKEETLSYRVKTLKLTEKGRRLAECLEKCRDVLG 93 SCOP domains d2pg4b_ B: Uncharacterized protein APE0880.1 SCOP domains CATH domains 2pg4B00 B:3-93 'winged helix' repressor DNA binding domain CATH domains Pfam domains ------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------- Transcript 2pg4 B 3 DETLRLQFGHLIRILPTLLEFEKKGYEPSLAEIVKASGVSEKTFFmGLKDRLIRAGLVKEETLSYRVKTLKLTEKGRRLAECLEKCRDVLG 93 12 22 32 42 | 52 62 72 82 92 48-MSE
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 2PG4) |
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2PG4)
|
|
|
|
|
|
|