|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (1, 2) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2PC0) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2PC0) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2PC0) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2PC0) |
Exons (0, 0)| (no "Exon" information available for 2PC0) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:99 aligned with A3FH86_9HIV1 | A3FH86 from UniProtKB/TrEMBL Length:99 Alignment length:99 10 20 30 40 50 60 70 80 90 A3FH86_9HIV1 1 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 99 SCOP domains d2pc0a_ A: Human immunodeficiency virus type 1 protease SCOP domains CATH domains 2pc0A00 A:1001-1099 Acid Proteases CATH domains Pfam domains ---RVP-2pc0A01 A:1004-1098 - Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------- Transcript 2pc0 A 1001 PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1099 1010 1020 1030 1040 1050 1060 1070 1080 1090 Chain A from PDB Type:PROTEIN Length:99 aligned with Q903N5_9HIV1 | Q903N5 from UniProtKB/TrEMBL Length:99 Alignment length:99 10 20 30 40 50 60 70 80 90 Q903N5_9HIV1 1 PQITLWRRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 99 SCOP domains d2pc0a_ A: Human immunodeficiency virus type 1 protease SCOP domains CATH domains 2pc0A00 A:1001-1099 Acid Proteases CATH domains Pfam domains ---RVP-2pc0A01 A:1004-1098 - Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------- Transcript 2pc0 A 1001 PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 1099 1010 1020 1030 1040 1050 1060 1070 1080 1090
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (4, 8)|
Asymmetric Unit(hide GO term definitions) Chain A (Q903N5_9HIV1 | Q903N5)
Chain A (A3FH86_9HIV1 | A3FH86)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|