|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2P8T) |
Sites (0, 0)| (no "Site" information available for 2P8T) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2P8T) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2P8T) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2P8T) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2P8T) |
Exons (0, 0)| (no "Exon" information available for 2P8T) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:184 aligned with O58461_PYRHO | O58461 from UniProtKB/TrEMBL Length:214 Alignment length:186 37 47 57 67 77 87 97 107 117 127 137 147 157 167 177 187 197 207 O58461_PYRHO 28 EYTVEDVLAVIFLLKEPLGRKQISERLELGEGSVRTLLRKLSHLDIIRSKQRGHFLTLKGKEIRDKLLSMFSEPIGVSVDGYPGIAIVVKNPPEFKSIELRDEAIKFDAKGAMILTVKDNEIVFPEDFRPLKEMYPEVAKKIVDYEDGDAVIITWAETPAKALKSAIHVAYILKKEEITPEILEVV 213 SCOP domains d2p8ta1 A:14-82 Hypothetical protein PH0730 d2p8ta2 A:83-199 Hypothetical protein PH0730 SCOP domains CATH domains 2p8tA01 A:14-82,A:192-199 'winged helix' repressor DNA binding doma2p8tA02 A:83-191 [code=3.30.1360.30, no name defined] 2p8tA01 CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 2p8t A 14 EYTVEDVLAVIFLLKEPLGRKQISERLELGEGSVRTLLRKLSHLDIIRSK--GHFLTLKGKEIRDKLLSMFSEPIGVSVDGYPGIAIVVKNPPEFKSIELRDEAIKFDAKGAMILTVKDNEIVFPEDFRPLKEMYPEVAKKIVDYEDGDAVIITWAETPAKALKSAIHVAYILKKEEITPEILEVV 199 23 33 43 53 63 | 73 83 93 103 113 123 133 143 153 163 173 183 193 63 66
|
||||||||||||||||||||
SCOP Domains (2, 2)| Asymmetric/Biological Unit |
CATH Domains (2, 2)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2P8T) |
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (O58461_PYRHO | O58461)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|