|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (3, 13) Biological Unit 1 (2, 22) |
Asymmetric Unit (3, 3)
|
(no "SS Bond" information available for 2P06) |
(no "Cis Peptide Bond" information available for 2P06) |
(no "SAP(SNP)/Variant" information available for 2P06) |
(no "PROSITE Motif" information available for 2P06) |
(no "Exon" information available for 2P06) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:84 aligned with Y060_ARCFU | O30176 from UniProtKB/Swiss-Prot Length:93 Alignment length:84 10 20 30 40 50 60 70 80 Y060_ARCFU 1 MDYFRLAEKFLREMHAKYMKRVSRPGNTPRPWFDFSEERLLSRLFEEMDELREAVEKEDWENLRDELLDVANFCMYLWGKLSVK 84 SCOP domains d2p06a1 A:1-84 Hypothetical protein AF0060 SCOP domains CATH domains -2p06A00 A:2-84 all-alpha NTP pyrophosphatases CATH domains Pfam domains ------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------ Transcript 2p06 A 1 mDYFRLAEKFLREmHAKYmKRVSRPGNTPRPWFDFSEERLLSRLFEEmDELREAVEKEDWENLRDELLDVANFCmYLWGKLSVK 84 | 10 | 20 30 40 |50 60 70 | 80 | 14-MSE| 48-MSE 75-MSE 1-MSE 19-MSE Chain B from PDB Type:PROTEIN Length:88 aligned with Y060_ARCFU | O30176 from UniProtKB/Swiss-Prot Length:93 Alignment length:88 1 | 5 15 25 35 45 55 65 75 Y060_ARCFU - -----MDYFRLAEKFLREMHAKYMKRVSRPGNTPRPWFDFSEERLLSRLFEEMDELREAVEKEDWENLRDELLDVANFCMYLWGKLSV 83 SCOP domains -----d2p06b1 B:1-83 Hypothetical protein AF0060 SCOP domains CATH domains 2p06B00 B:-4-83 all-alpha NTP pyrophosphatases CATH domains Pfam domains (1) ---------------------------------------MazG-2p06B01 B:35-83 Pfam domains (1) Pfam domains (2) ---------------------------------------MazG-2p06B02 B:35-83 Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------- Transcript 2p06 B -4 LYFQGmDYFRLAEKFLREmHAKYmKRVSRPGNTPRPWFDFSEERLLSRLFEEmDELREAVEKEDWENLRDELLDVANFCmYLWGKLSV 83 | 5 15 | 25 35 45 | 55 65 75 1-MSE 14-MSE| 48-MSE 75-MSE 19-MSE
|
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2P06)
|
|
|
|
|
|
|