Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN PHYTANOYL-COA DIOXYGENASE PHYHD1 (APO)
 
Authors :  Z. Zhang, D. Butler, M. A. Mcdonough, K. L. Kavanagh, J. E. Bray, S. S. Ng, Delft, C. H. Arrowsmith, J. Weigelt, A. Edwards, M. Sundstrom, C. J. Sc U. Oppermann, Structural Genomics Consortium (Sgc)
Date :  30 Jan 07  (Deposition) - 06 Mar 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A
Keywords :  Phyhd1, Double-Stranded Beta Helix, Oxygenase, Structural Genomics, Structural Genomics Consortium, Sgc, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Z. Zhang, D. Butler, M. A. Mcdonough, K. L. Kavanagh, J. E. Bray, S. S. Ng F. Von Delft, C. H. Arrowsmith, J. Weigelt, A. Edwards, M. Sundstrom, C. J. Schofield, U. Oppermann
Crystal Structure Of Human Phytanoyl-Coa Dioxygenase Phyhd1 (Apo)
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PHYHD1 PROTEIN
    ChainsA
    EC Number1.14.11.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GenePHYHD1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPHYTANOYL-COA DIOXYGENASE DOMAIN CONTAINING 1
    TissueLUNG

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2OPW)

(-) Sites  (0, 0)

(no "Site" information available for 2OPW)

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:3 -A:3

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Gly A:104 -His A:105
2Glu A:165 -Pro A:166

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 1)

Asymmetric/Biological Unit (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_050529R222WPHYD1_HUMANPolymorphism10988159AR222W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2OPW)

(-) Exons   (11, 11)

Asymmetric/Biological Unit (11, 11)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003725921aENSE00001404383chr9:131683174-131683947774PHYD1_HUMAN-00--
1.2bENST000003725922bENSE00001426496chr9:131684209-131684326118PHYD1_HUMAN-00--
1.3aENST000003725923aENSE00001412360chr9:131684562-13168463574PHYD1_HUMAN1-11111A:2-1110
1.4bENST000003725924bENSE00002172845chr9:131689317-131689475159PHYD1_HUMAN12-64531A:12-6453
1.5cENST000003725925cENSE00001622652chr9:131696061-13169613676PHYD1_HUMAN65-90261A:65-9026
1.6aENST000003725926aENSE00001653906chr9:131696290-13169633748PHYD1_HUMAN90-106171A:90-10617
1.7ENST000003725927ENSE00001591889chr9:131698727-13169878256PHYD1_HUMAN106-124191A:106-12419
1.8ENST000003725928ENSE00001744807chr9:131698862-13169892463PHYD1_HUMAN125-145211A:125-14521
1.9bENST000003725929bENSE00001673454chr9:131700036-13170005722PHYD1_HUMAN146-15381A:146-1538
1.10bENST0000037259210bENSE00001757060chr9:131702648-131702776129PHYD1_HUMAN153-196441A:153-19644
1.10eENST0000037259210eENSE00001619664chr9:131702878-131702994117PHYD1_HUMAN196-235401A:196-235 (gaps)40
1.11aENST0000037259211aENSE00001776873chr9:131703724-131703850127PHYD1_HUMAN235-277431A:235-27743
1.11dENST0000037259211dENSE00001853182chr9:131703947-131704316370PHYD1_HUMAN277-291151A:277-29115

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:286
 aligned with PHYD1_HUMAN | Q5SRE7 from UniProtKB/Swiss-Prot  Length:291

    Alignment length:290
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291
          PHYD1_HUMAN     2 ACLSPSQLQKFQQDGFLVLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEFSTQEEEQLRAQGSTDYFLSSGDKIRFFFEKGVFDEKGNFLVPPEKSINKIGHALHAHDPVFKSITHSFKVQTLARSLGLQMPVVVQSMYIFKQPHFGGEVSPHQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSGVSRRMVRAPVGSAPGTSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTWSPENWLQPTAELPFPQLYT 291
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------PhyH-2opwA01 A:12-259                                                                                                                                                                                                                                   -------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhheeee....hhhhhhhhhhhhhhhhhh...hhhhh....hhhhhhhhhhhhhhhhhh....eeeee.............hhhh.eeeeeehhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeeee.........eeeehhhhh..ee....eeeeeee..........eeee.........eeeee..----..eeeee.....hhhhheee......eeeee...eeee..........eeeeeeee....ee................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------W--------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3a Exon 1.4b  PDB: A:12-64 UniProt: 12-64               Exon 1.5c  PDB: A:65-90   ---------------Exon 1.7           Exon 1.8             -------Exon 1.10b  PDB: A:153-196 UniProt: 153-196 --------------------------------------Exon 1.11a  PDB: A:235-277 UniProt: 235-277-------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------Exon 1.6a        ---------------------------------------1.9b    ------------------------------------------Exon 1.10e  PDB: A:196-235 (gaps)       -----------------------------------------Exon 1.11d      Transcript 1 (2)
                 2opw A   2 ACLSPSQLQKFQQDGFLVLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEFSTQEEEQLRAQGSTDYFLSSGDKIRFFFEKGVFDEKGNFLVPPEKSINKIGHALHAHDPVFKSITHSFKVQTLARSLGLQMPVVVQSMYIFKQPHFGGEVSPHQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSGVSRRMVRAP----PGTSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTWSPENWLQPTAELPFPQLYT 291
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201    |  211       221       231       241       251       261       271       281       291
                                                                                                                                                                                                                                      206  211                                                                                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2OPW)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2OPW)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: Cupin (179)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (PHYD1_HUMAN | Q5SRE7)
molecular function
    GO:0051213    dioxygenase activity    Catalysis of an oxidation-reduction (redox) reaction in which both atoms of oxygen from one molecule of O2 are incorporated into the (reduced) product(s) of the reaction. The two atoms of oxygen may be distributed between two different products.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2opw)
 
  Sites
(no "Sites" information available for 2opw)
 
  Cis Peptide Bonds
    Glu A:165 - Pro A:166   [ RasMol ]  
    Gly A:104 - His A:105   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2opw
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PHYD1_HUMAN | Q5SRE7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.14.11.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PHYD1_HUMAN | Q5SRE7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PHYD1_HUMAN | Q5SRE73obz

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2OPW)