Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE YUEI PROTEIN FROM BACILLUS SUBTILIS
 
Authors :  J. B. Bonanno, X. Jin, H. Mu, M. Dickey, K. T. Bain, B. Wu, T. Chen, C. Reyes S. Wasserman, D. Smith, J. M. Sauder, S. K. Burley, S. C. Almo, New York Research Center For Structural Genomics (Nysgxrc)
Date :  10 Jan 07  (Deposition) - 23 Jan 07  (Release) - 24 Oct 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.40
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Structural Genomics, Psi-2, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. B. Bonanno, X. Jin, H. Mu, M. Dickey, K. T. Bain, B. Wu, T. Chen, C. Reyes, S. Wasserman, D. Smith, J. M. Sauder, S. K. Burley, S. C. Almo
Crystal Structure Of The Yuei Protein From Bacillus Subtili
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - YUEI PROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidMODIFIED PET26
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System VectorPET
    Expression System Vector TypePLASMID
    GeneYUEI
    Organism ScientificBACILLUS SUBTILIS
    Organism Taxid1423

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2OHW)

(-) Sites  (0, 0)

(no "Site" information available for 2OHW)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2OHW)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2OHW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2OHW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2OHW)

(-) Exons   (0, 0)

(no "Exon" information available for 2OHW)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:128
 aligned with YUEI_BACSU | O32092 from UniProtKB/Swiss-Prot  Length:132

    Alignment length:128
                                    12        22        32        42        52        62        72        82        92       102       112       122        
           YUEI_BACSU     3 EDKMDLYLQQGMYGPLETKPDERHLFLGSLRERVVLALTKGQVLRSKPYKEAEHELKNSHNVTLLINGELQYQSYSSYIQMASRYGVPFKIVSDLQFHTPLGIVIAADIAVNRELIYIQDDIYNRSVL 130
               SCOP domains d2ohwa1 A:3-130 Uncharacterized protein YueI                                                                                     SCOP domains
               CATH domains 2ohwA00 A:3-130  [code=3.30.1330.30, no name defined]                                                                            CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhh.......hhhhhhhhh...hhh.eeeeeehhhhh....hhhhhhhhhh...eeeeee...hhhhhhhhhhhhhhh...eeee........eeeeeee............hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ohw A   3 EDKMDLYLQQGMYGPLETKPDERHLFLGSLRERVVLALTKGQVLRSKPYKEAEHELKNSHNVTLLINGELQYQSYSSYIQMASRYGVPFKIVSDLQFHTPLGIVIAADIAVNRELIYIQDDIYNRSVL 130
                                    12        22        32        42        52        62        72        82        92       102       112       122        

Chain B from PDB  Type:PROTEIN  Length:128
 aligned with YUEI_BACSU | O32092 from UniProtKB/Swiss-Prot  Length:132

    Alignment length:128
                                    12        22        32        42        52        62        72        82        92       102       112       122        
           YUEI_BACSU     3 EDKMDLYLQQGMYGPLETKPDERHLFLGSLRERVVLALTKGQVLRSKPYKEAEHELKNSHNVTLLINGELQYQSYSSYIQMASRYGVPFKIVSDLQFHTPLGIVIAADIAVNRELIYIQDDIYNRSVL 130
               SCOP domains d2ohwb_ B: Uncharacterized protein YueI                                                                                          SCOP domains
               CATH domains 2ohwB00 B:3-130  [code=3.30.1330.30, no name defined]                                                                            CATH domains
           Pfam domains (1) DUF1694-2ohwB01 B:3-120                                                                                               ---------- Pfam domains (1)
           Pfam domains (2) DUF1694-2ohwB02 B:3-120                                                                                               ---------- Pfam domains (2)
         Sec.struct. author hhhhhhhhhh.......hhhhhhhhh...hhh.eeeeeehhhhh....hhhhhhhhhhh..eeeeee...hhhhhhhhhhhhhhh...eeee........eeeeeee............hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ohw B   3 EDKMDLYLQQGMYGPLETKPDERHLFLGSLRERVVLALTKGQVLRSKPYKEAEHELKNSHNVTLLINGELQYQSYSSYIQMASRYGVPFKIVSDLQFHTPLGIVIAADIAVNRELIYIQDDIYNRSVL 130
                                    12        22        32        42        52        62        72        82        92       102       112       122        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric Unit

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2OHW)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ohw)
 
  Sites
(no "Sites" information available for 2ohw)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ohw)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ohw
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  YUEI_BACSU | O32092
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  YUEI_BACSU | O32092
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2OHW)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2OHW)