![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (3, 4)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 2OBP) |
(no "Cis Peptide Bond" information available for 2OBP) |
(no "SAP(SNP)/Variant" information available for 2OBP) |
(no "PROSITE Motif" information available for 2OBP) |
(no "Exon" information available for 2OBP) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:81 aligned with Q46TT3_CUPNJ | Q46TT3 from UniProtKB/TrEMBL Length:95 Alignment length:81 21 31 41 51 61 71 81 91 Q46TT3_CUPNJ 12 GIDPAIVEVLLVLREAGIENGATPWSLPKIAKRAQLPMSVLRRVLTQLQAAGLADVSVEADGRGHASLTQEGAALAAQLFP 92 SCOP domains d2obpa1 A:12-92 Putative DNA-binding protein ReutB4095 SCOP domains CATH domains 2obpA00 A:12-92 'winged helix' repressor DNA binding domain CATH domains Pfam domains --------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------- Transcript 2obp A 12 GIDPAIVEVLLVLREAGIENGATPWSLPKIAKRAQLPmSVLRRVLTQLQAAGLADVSVEADGRGHASLTQEGAALAAQLFP 92 21 31 41 |51 61 71 81 91 49-MSE Chain B from PDB Type:PROTEIN Length:81 aligned with Q46TT3_CUPNJ | Q46TT3 from UniProtKB/TrEMBL Length:95 Alignment length:81 21 31 41 51 61 71 81 91 Q46TT3_CUPNJ 12 GIDPAIVEVLLVLREAGIENGATPWSLPKIAKRAQLPMSVLRRVLTQLQAAGLADVSVEADGRGHASLTQEGAALAAQLFP 92 SCOP domains d2obpb_ B: Putative DNA-binding protein ReutB4095 SCOP domains CATH domains 2obpB00 B:12-92 'winged helix' repressor DNA binding domain CATH domains Pfam domains --------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------- Transcript 2obp B 12 GIDPAIVEVLLVLREAGIENGATPWSLPKIAKRAQLPmSVLRRVLTQLQAAGLADVSVEADGRGHASLTQEGAALAAQLFP 92 21 31 41 |51 61 71 81 91 49-MSE
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 2OBP) |
Asymmetric Unit(hide GO term definitions) Chain A,B (Q46TT3_CUPNJ | Q46TT3)
|
|
|
|
|
|
|