|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 6)| Asymmetric/Biological Unit (2, 6) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2O38) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2O38) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2O38) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2O38) |
Exons (0, 0)| (no "Exon" information available for 2O38) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:89 aligned with Q6N370_RHOPA | Q6N370 from UniProtKB/TrEMBL Length:116 Alignment length:89 37 47 57 67 77 87 97 107 Q6N370_RHOPA 28 PDAEERQTKLRLAYALNAVIDRARLSQAAAAARLGINQPKVSALRNYKLEGFSVERLMTLLNALDQDVEIVIRKKPRSRAAARISVVAA 116 SCOP domains d2o38a1 A:28-116 Hypothetical protein RPA3824 SCOP domains CATH domains 2o38A01 A:28-92 lambda repressor-like DNA-binding domains ------------------------ CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------- Transcript 2o38 A 28 PDAEERQTKLRLAYALNAVIDRARLSQAAAAARLGINQPKVSALRNYKLEGFSVERLmTLLNALDQDVEIVIRKKPRSRAAARISVVAA 116 37 47 57 67 77 |87 97 107 85-MSE Chain B from PDB Type:PROTEIN Length:90 aligned with Q6N370_RHOPA | Q6N370 from UniProtKB/TrEMBL Length:116 Alignment length:90 36 46 56 66 76 86 96 106 116 Q6N370_RHOPA 27 MPDAEERQTKLRLAYALNAVIDRARLSQAAAAARLGINQPKVSALRNYKLEGFSVERLMTLLNALDQDVEIVIRKKPRSRAAARISVVAA 116 SCOP domains d2o38b_ B: Hypothetical protein RPA3824 SCOP domains CATH domains -2o38B01 B:28-92 lambda repressor-like DNA-binding domains ------------------------ CATH domains Pfam domains (1) HTH_37-2o38B01 B:27-100 ---------------- Pfam domains (1) Pfam domains (2) HTH_37-2o38B02 B:27-100 ---------------- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------ Transcript 2o38 B 27 mPDAEERQTKLRLAYALNAVIDRARLSQAAAAARLGINQPKVSALRNYKLEGFSVERLmTLLNALDQDVEIVIRKKPRSRAAARISVVAA 116 | 36 46 56 66 76 86 96 106 116 27-MSE 85-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (1, 2)
Asymmetric/Biological Unit
|
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (1, 1)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q6N370_RHOPA | Q6N370)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|