Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  PUTATIVE XRE FAMILY TRANSCRIPTIONAL REGULATOR
 
Authors :  Y. Kim, A. Joachimiak, E. Evdokimova, O. Kagan, A. Edwards, A. Savchenk Center For Structural Genomics (Mcsg)
Date :  30 Nov 06  (Deposition) - 02 Jan 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.83
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Alpha-Beta, Helix-Turn-Helix, Structural Genomics, Psi-2, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Kim, E. Evdokimova, O. Kagan, A. Edwards, A. Savchenko, A. Joachimiak
The Crystal Structure Of Putative Xre Family Transcriptiona Regulator
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidMODIFIED PET
    Expression System StrainBL21DE3
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneRPA3824
    Organism ScientificRHODOPSEUDOMONAS PALUSTRIS
    Organism Taxid258594
    StrainCGA009
    SynonymUNCHARACTERIZED CONSERVED SMALL PROTEIN COG560

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 6)

Asymmetric/Biological Unit (2, 6)
No.NameCountTypeFull Name
1ACY3Ligand/IonACETIC ACID
2MSE3Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:44 , ASP A:48 , TYR A:74 , ARG B:60BINDING SITE FOR RESIDUE ACY A 201
2AC2SOFTWAREALA A:56 , ALA A:59 , ARG A:60 , TYR B:41 , ASN B:44 , ASP B:48 , TYR B:74BINDING SITE FOR RESIDUE ACY B 201
3AC3SOFTWAREILE A:99 , ALA B:42 , VAL B:46 , ARG B:49 , GLN B:93 , ALA B:115 , HOH B:226BINDING SITE FOR RESIDUE ACY B 202

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2O38)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2O38)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2O38)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2O38)

(-) Exons   (0, 0)

(no "Exon" information available for 2O38)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:89
 aligned with Q6N370_RHOPA | Q6N370 from UniProtKB/TrEMBL  Length:116

    Alignment length:89
                                    37        47        57        67        77        87        97       107         
         Q6N370_RHOPA    28 PDAEERQTKLRLAYALNAVIDRARLSQAAAAARLGINQPKVSALRNYKLEGFSVERLMTLLNALDQDVEIVIRKKPRSRAAARISVVAA 116
               SCOP domains d2o38a1 A:28-116 Hypothetical protein RPA3824                                             SCOP domains
               CATH domains 2o38A01 A:28-92 lambda repressor-like DNA-binding domains        ------------------------ CATH domains
               Pfam domains ----------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh.hhhhhhhhhh......hhhhhhhhhhhh.eeeeeeeee.........eeeeee Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------- Transcript
                 2o38 A  28 PDAEERQTKLRLAYALNAVIDRARLSQAAAAARLGINQPKVSALRNYKLEGFSVERLmTLLNALDQDVEIVIRKKPRSRAAARISVVAA 116
                                    37        47        57        67        77       |87        97       107         
                                                                                    85-MSE                           

Chain B from PDB  Type:PROTEIN  Length:90
 aligned with Q6N370_RHOPA | Q6N370 from UniProtKB/TrEMBL  Length:116

    Alignment length:90
                                    36        46        56        66        76        86        96       106       116
         Q6N370_RHOPA    27 MPDAEERQTKLRLAYALNAVIDRARLSQAAAAARLGINQPKVSALRNYKLEGFSVERLMTLLNALDQDVEIVIRKKPRSRAAARISVVAA 116
               SCOP domains d2o38b_ B: Hypothetical protein RPA3824                                                    SCOP domains
               CATH domains -2o38B01 B:28-92 lambda repressor-like DNA-binding domains        ------------------------ CATH domains
           Pfam domains (1) HTH_37-2o38B01 B:27-100                                                   ---------------- Pfam domains (1)
           Pfam domains (2) HTH_37-2o38B02 B:27-100                                                   ---------------- Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh.hhhhhhhhhh......hhhhhhhhhhhh.eeeeeeeee.........eeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------ Transcript
                 2o38 B  27 mPDAEERQTKLRLAYALNAVIDRARLSQAAAAARLGINQPKVSALRNYKLEGFSVERLmTLLNALDQDVEIVIRKKPRSRAAARISVVAA 116
                            |       36        46        56        66        76        86        96       106       116
                           27-MSE                                                    85-MSE                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: HTH (544)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q6N370_RHOPA | Q6N370)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2o38)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2o38
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q6N370_RHOPA | Q6N370
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q6N370_RHOPA | Q6N370
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2O38)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2O38)