Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CARBOHYDRATE KINASE FROM AGROBACTERIUM TUMEFACIENS
 
Authors :  J. Osipiuk, X. Xu, J. Gu, A. Savchenko, A. Edwards, A. Joachimiak, Midwe For Structural Genomics (Mcsg)
Date :  14 Nov 06  (Deposition) - 12 Dec 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.86
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  A  (2x)
Keywords :  Carbohydrate Kinase; Structural Genomics; Apc6199; Psi-2; Protein Structure Initiative 2; Midwest Center For Structural Genomics; Mcsg, Signaling Protein, Transferase, Signaling Protein, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Osipiuk, X. Xu, J. Gu, A. Savchenko, A. Edwards, A. Joachimiak
X-Ray Crystal Structure Of Carbohydrate Kinase From Agrobacterium Tumefaciens
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - CARBOHYDRATE KINASE
    Atcc33970
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET15B
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneATU1875
    Organism ScientificAGROBACTERIUM TUMEFACIENS STR.
    Organism Taxid176299
    StrainC58
    SynonymAGR_C_3442P

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (1x)A
Biological Unit 2 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 4)

Asymmetric Unit (3, 4)
No.NameCountTypeFull Name
1CA2Ligand/IonCALCIUM ION
2CL1Ligand/IonCHLORIDE ION
3NA1Ligand/IonSODIUM ION
Biological Unit 1 (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2CL-1Ligand/IonCHLORIDE ION
3NA-1Ligand/IonSODIUM ION
Biological Unit 2 (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2CL-1Ligand/IonCHLORIDE ION
3NA-1Ligand/IonSODIUM ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREALA A:176 , ASP A:297 , HOH A:455 , HOH A:509 , HOH A:587BINDING SITE FOR RESIDUE CA A 401
2AC2SOFTWAREGLU A:19 , ASP A:111 , HOH A:539 , HOH A:545BINDING SITE FOR RESIDUE CA A 402
3AC3SOFTWAREGLY A:38 , GLY A:39 , ASN A:141 , HOH A:479 , HOH A:658BINDING SITE FOR RESIDUE CL A 403
4AC4SOFTWAREASP A:247 , THR A:249BINDING SITE FOR RESIDUE NA A 404

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2NWH)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2NWH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2NWH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2NWH)

(-) Exons   (0, 0)

(no "Exon" information available for 2NWH)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:307
 aligned with A9CII5_AGRFC | A9CII5 from UniProtKB/TrEMBL  Length:297

    Alignment length:312
                                            1                                                                                                                                                                                                                                                                                                       
                                     -      |  4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294  
         A9CII5_AGRFC     - ----------------MIETETAPGASNPGSWMEEAGGGGFNAARNLSRLGFEVRIIAPRGGDVTGEVVAEAARQAGVEDTPFTFLDRRTPSYTAILERDGNLVIALADMDLYKLFTPRRLKVRAVREAIIASDFLLCDANLPEDTLTALGLIARACEKPLAAIAISPAKAVKLKAALGDIDILFMNEAEARALTGETAENVRDWPNILRKAGLSGGVVTRGASEVVAFNGTEKAILHPPLIREVKDVTGAGDAMASGYLAAIAEGKTIREALRQGAAAAAITVQSSFATSQDLSKDSVEAMLGLVPQAEML 296
               SCOP domains d2nwha_ A: automated matches                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 2nwhA00 A:1-312  [code=3.40.1190.20, no name defined]                                                                                                                                                                                                                                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeee...eeeeeeee...........eeeeeeeehhhhhhhhhhhhh..eeeee.eee.hhhhhhhhhhhhhh..ee..eee......eeeeee.....eeeeeeehhhhhhhhhhhhhhhhhhhhhhhh.eeeee...hhhhhhhhhhhhhhh...eeee..hhhhhhhhh.hhhhh.eeeeehhhhhhhhh-----..hhhhhhhhh....eeeee...eeeee....eeee..............hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh....eee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2nwh A   1 MKKILVLGGAHIDRRGMIETETAPGASNPGSWMEEAGGGGFNAARNLSRLGFEVRIIAPRGGDVTGEVVAEAARQAGVEDTPFTFLDRRTPSYTAILERDGNLVIALADMDLYKLFTPRRLKVRAVREAIIASDFLLCDANLPEDTLTALGLIARACEKPLAAIAISPAKAVKLKAALGDIDILFMNEAEARALTG-----VRDWPNILRKAGLSGGVVTRGASEVVAFNGTEKAILHPPLIREVKDVTGAGDAMASGYLAAIAEGKTIREALRQGAAAAAITVQSSFATSQDLSKDSVEAMLGLVPQAEML 312
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190     |   - |     210       220       230       240       250       260       270       280       290       300       310  
                                                                                                                                                                                                                             196   202                                                                                                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2NWH)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A   (A9CII5_AGRFC | A9CII5)
molecular function
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0016773    phosphotransferase activity, alcohol group as acceptor    Catalysis of the transfer of a phosphorus-containing group from one compound (donor) to an alcohol group (acceptor).
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2nwh)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2nwh
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A9CII5_AGRFC | A9CII5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A9CII5_AGRFC | A9CII5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2NWH)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2NWH)