|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric Unit (2, 4) Biological Unit 1 (2, 8) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2NVN) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2NVN) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2NVN) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2NVN) |
Exons (0, 0)| (no "Exon" information available for 2NVN) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:121 aligned with Q31MH7_SYNE7 | Q31MH7 from UniProtKB/TrEMBL Length:121 Alignment length:121 10 20 30 40 50 60 70 80 90 100 110 120 Q31MH7_SYNE7 1 MGRILREGAGWRLGWDETAHRYPGLVGTTDWAVELTAAEMADFCRLVQQLAETIAAIAPELMPEERLQIEAESALLWLEAEGFADAYELRLILASDRRVEACWPAAAVPALVAATHTLKGF 121 SCOP domains d2nvna1 A:1-121 Hypothetical protein syc2379_c SCOP domains CATH domains -2nvnA00 A:2-121 Transcriptional Coactivator Pc4; Chain A CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript 2nvn A 1 mGRILREGAGWRLGWDETAHRYPGLVGTTDWAVELTAAEmADFCRLVQQLAETIAAIAPELmPEERLQIEAESALLWLEAEGFADAYELRLILASDRRVEACWPAAAVPALVAATHTLKGF 121 | 10 20 30 40 50 60 | 70 80 90 100 110 120 | 40-MSE 62-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2NVN) |
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A (Q31MH7_SYNE7 | Q31MH7)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|