|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 5)
Asymmetric Unit (2, 5)
|
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2NR9) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2NR9) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2NR9) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2NR9) |
Exons (0, 0)| (no "Exon" information available for 2NR9) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:192 aligned with GLPG_HAEIN | P44783 from UniProtKB/Swiss-Prot Length:192 Alignment length:192 192 13 23 33 43 53 63 73 83 93 103 113 123 133 143 153 163 173 183 |- GLPG_HAEIN 4 FLAQQGKITLILTALCVLIYLAQQLGFEDDIMYLMHYPAYEEQDSEVWRYISHTLVHLSNLHILFNLSWFFIFGGMIERTFGSVKLLMLYVVASAITGYVQNYVSGPAFFGLSGVVYAVLGYVFIRDKLNHHLFDLPEGFFTMLLVGIALGFISPLFGVEMGNAAHISGLIVGLIWGFIDSKLRKNSLE--- - SCOP domains d2nr9a1 A:4-192 GlpG homolog HI0618 --- SCOP domains CATH domains 2nr9A00 A:4-195 Rhomboid-like domains CATH domains Pfam domains ----------------------------------------Rhomboid-2nr9A01 A:44-188 ------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 2nr9 A 4 FLAQQGKITLILTALCVLIYIAQQLGFEDDIMYLMHYPAYEEQDSEVWRYISHTLVHLSNLHILFNLSWFFIFGGMIERTFGSVKLLMLYVVASAITGYVQNYVSGPAFFGLSGVVYAVLGYVFIRDKLNHHLFDLPEGFFTMLLVGIALGFISPLFGVEMGNAAHISGLIVGLIWGFIDSKLRKNSLELVP 195 13 23 33 43 53 63 73 83 93 103 113 123 133 143 153 163 173 183 193
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (10, 10)|
Asymmetric Unit(hide GO term definitions) Chain A (GLPG_HAEIN | P44783)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|