Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURE OF THE MYCOBACTERIUM TUBERCULOSIS LPPM (RV2171) PROTEIN FOLDED DOMAIN
 
Authors :  P. Barthe, M. Cohen-Gonsaud
Date :  22 Mar 16  (Deposition) - 14 Sep 16  (Release) - 19 Oct 16  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (30x)
NMR Structure *:  A  (1x)
Keywords :  Transport Protein, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. Barthe, R. Veyron-Churlet, A. De Visch, M. Gilleron, J. M. Saliou, S. Tomavo, J. Nigou, P. Brodin, M. Cohen-Gonsaud
Mycobacterium Tuberculosis Lppm Displays An Original Structure And Domain Composition Linked To A Dual Localization.
Structure V. 24 1788 2016
PubMed-ID: 27568926  |  Reference-DOI: 10.1016/J.STR.2016.07.009

(-) Compounds

Molecule 1 - LIPOPROTEIN LPPM
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21
    Expression System Taxid: 469008
    Expression System Variant: DE3
    Fragment: RESIDUES 26-185
    Gene: LPPM, AFL40_2254, BN1213_00992, BN1303_00406, ERS007661_00910, ERS007663_00966, ERS007665_02632, ERS007670_01654, ERS007672_03318, ERS007679_00953, ERS007681_03123, ERS007688_03112, ERS007720_03717, ERS007722_01662, ERS013447_03488, ERS013471_03169, ERS023446_03335, ERS024213_03999, ERS027644_02995, ERS027653_02310, ERS027656_02172, ERS027666_01329, ERS031493_03859, ERS031537_04052, ERS075357_01597, ERS075361_03109, ERS075387_02172, ERS124361_03770, IQ38_09230, IQ40_08885, IQ42_08970, IQ45_08850, IQ47_08830, IQ48_08865, IU12_09440, IU13_08950, IU16_08915, IU17_08865, T209_08835
    Organism Scientific: MYCOBACTERIUM TUBERCULOSIS
    Organism Taxid: 1773
    Synonym: LIPOPROTEIN LPPM, LPPM, UNCHARACTERIZED PROTEIN

 Structural Features

(-) Chains, Units

  1
NMR Structure (30x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2NC8)

(-) Sites  (0, 0)

(no "Site" information available for 2NC8)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2NC8)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2NC8)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2NC8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2NC8)

(-) Exons   (0, 0)

(no "Exon" information available for 2NC8)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:171
 aligned with A0A045INR3_M | A0A045INR3 from UniProtKB/TrEMBL  Length:227

    Alignment length:184
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181    
         A0A045INR3_M     2 ARTRRRGMLAIAMLLMLVPLATGCLRVRASITISPDDLVSGEIIAAAKPKNSKDTGPALDGDVPFSQKVAVSNYDSDGYVGSQAVFSDLTFAELPQLANMNSDAAGVNLSLRRNGNIVILEGRADLTSVSDPDADVELTVAFPAAVTSTNGDRIEPEVVQWKLKPGVVSTMSAQARYTDPNTRS 185
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....-------------........eeeeeeeee...eeeeeeeeee.................hhh.eeeeeeee..eeeeeeeeeeee.hhhhhhhhhhhhhhh.eeeeeee..eeeeeeeee.........eeeeeee....eeeee.eeee..eeeeee....eeeeeeeee........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2nc8 A  15 GREN-------------LYFQGHMLRVRASITISPDDLVSGEIIAAAKPKNSKDTGPALDGDVPFSQKVAVSNYDSDGYVGSQAVFSDLTFAELPQLANMNSDAAGVNLSLRRNGNIVILEGRADLTSVSDPDADVELTVAFPAAVTSTNGDRIEPEVVQWKLKPGVVSTMSAQARYTDPNTRS 185
                               |     -       |21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181    
                              18            19                                                                                                                                                                      


Chain A from PDB  Type:PROTEIN  Length:171
 aligned with LPPM_MYCTU | O53505 from UniProtKB/Swiss-Prot  Length:227

    Alignment length:184
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181    
           LPPM_MYCTU     2 ARTRRRGMLAIAMLLMLVPLATGCLRVRASITISPDDLVSGEIIAAAKPKNSKDTGPALDGDVPFSQKVAVSNYDSDGYVGSQAVFSDLTFAELPQLANMNSDAAGVNLSLRRNGNIVILEGRADLTSVSDPDADVELTVAFPAAVTSTNGDRIEPEVVQWKLKPGVVSTMSAQARYTDPNTRS 185
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....-------------........eeeeeeeee...eeeeeeeeee.................hhh.eeeeeeee..eeeeeeeeeeee.hhhhhhhhhhhhhhh.eeeeeee..eeeeeeeee.........eeeeeee....eeeee.eeee..eeeeee....eeeeeeeee........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2nc8 A  15 GREN-------------LYFQGHMLRVRASITISPDDLVSGEIIAAAKPKNSKDTGPALDGDVPFSQKVAVSNYDSDGYVGSQAVFSDLTFAELPQLANMNSDAAGVNLSLRRNGNIVILEGRADLTSVSDPDADVELTVAFPAAVTSTNGDRIEPEVVQWKLKPGVVSTMSAQARYTDPNTRS 185
                               |     -       |21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181    
                              18            19
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2NC8)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2NC8)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2NC8)

(-) Gene Ontology  (4, 4)

NMR Structure(hide GO term definitions)
Chain A   (LPPM_MYCTU | O53505)
biological process
    GO:0052170    negative regulation by symbiont of host innate immune response    Any process in which an organism stops, prevents, or reduces the frequency, rate or extent of the innate immune response of the host organism, the host's first line of defense against infection. The host is defined as the larger of the organisms involved in a symbiotic interaction.
cellular component
    GO:0005618    cell wall    The rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal, most prokaryotic cells and some protozoan parasites, maintaining their shape and protecting them from osmotic lysis. In plants it is made of cellulose and, often, lignin; in fungi it is composed largely of polysaccharides; in bacteria it is composed of peptidoglycan; in protozoan parasites such as Giardia species, it's made of carbohydrates and proteins.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Chain A   (A0A045INR3_M | A0A045INR3)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2nc8)
 
  Sites
(no "Sites" information available for 2nc8)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2nc8)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2nc8
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A0A045INR3_M | A0A045INR3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  LPPM_MYCTU | O53505
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A0A045INR3_M | A0A045INR3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  LPPM_MYCTU | O53505
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2NC8)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2NC8)