Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF MOUSE PHEROMONE ESP1
 
Authors :  S. Yoshinaga, T. Sato, M. Hirakane, K. Esaki, T. Hamaguchi, S. Haga-Yam M. Tsunoda, H. Kimoto, I. Shimada, K. Touhara, H. Terasawa
Date :  06 Dec 11  (Deposition) - 17 Apr 13  (Release) - 24 Apr 13  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Pheromone, Gpcr, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Yoshinaga, T. Sato, M. Hirakane, K. Esaki, T. Hamaguchi, S. Haga-Yamanaka, M. Tsunoda, H. Kimoto, I. Shimada, K. Touhara, H. Terasawa
Structure Of The Mouse Sex Peptide Pheromone Esp1 Reveals A Molecular Basis For Specific Binding To The Class-C G-Protein-Coupled Vomeronasal Receptor
J. Biol. Chem. 2013
PubMed-ID: 23576433  |  Reference-DOI: 10.1074/JBC.M112.436782

(-) Compounds

Molecule 1 - EXOCRINE GLAND-SECRETING PEPTIDE 1
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)
    Expression System Taxid562
    Expression System VectorPET28A
    FragmentUNP RESIDUES 48-102
    GeneEG619517, ESP1, GM6084
    Organism CommonMOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
    StrainBALB/C
    SynonymESP1

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2LMK)

(-) Sites  (0, 0)

(no "Site" information available for 2LMK)

(-) SS Bonds  (1, 1)

NMR Structure
No.Residues
1A:63 -A:95

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2LMK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2LMK)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2LMK)

(-) Exons   (0, 0)

(no "Exon" information available for 2LMK)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:57
 aligned with ESP1_MOUSE | Q3LHH8 from UniProtKB/Swiss-Prot  Length:102

    Alignment length:81
                                    31        41        51        61        71        81        91       101 
           ESP1_MOUSE    22 GRVLTQTGKEATIFADQKTNHEADLKNPDPQEVQRALARILCALGELDKLVKDQANAGQQEFKLPKDFTGRSKCRSLGRIK 102
               SCOP domains --------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .------------------------.....hhhhhhhhhhhhhh..hhhhhhhhhh.........hhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------- Transcript
                 2lmk A  46 G------------------------SNPDPQEVQRALARILCALGELDKLVKDQANAGQQEFKLPKDFTGRSKCRSLGRIK 102
                            |        -         -     |  51        61        71        81        91       101 
                            |                       47                                                       
                           46                                                                                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2LMK)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2LMK)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2LMK)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (ESP1_MOUSE | Q3LHH8)
molecular function
    GO:0005186    pheromone activity    The activity of binding to and activating specific cell surface receptors, thereby inducing behavioral, developmental, or physiological response(s) from a responding organism or cell. The substance may be released or retained on the cell surface. Pheromones may serve as a specific attractant, social communicator, or sexual stimulant.
biological process
    GO:0007610    behavior    The internally coordinated responses (actions or inactions) of animals (individuals or groups) to internal or external stimuli, via a mechanism that involves nervous system activity.
    GO:0045925    positive regulation of female receptivity    Any process that activates or increases the receptiveness of a female to male advances.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2lmk)
 
  Sites
(no "Sites" information available for 2lmk)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2lmk)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2lmk
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ESP1_MOUSE | Q3LHH8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ESP1_MOUSE | Q3LHH8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2LMK)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2LMK)