|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2LM7) |
Sites (0, 0)| (no "Site" information available for 2LM7) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2LM7) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2LM7) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2LM7) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2LM7) |
Exons (0, 0)| (no "Exon" information available for 2LM7) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:61 aligned with VP7_ROT41 | Q3ZK60 from UniProtKB/Swiss-Prot Length:326 Alignment length:61 275 285 295 305 315 325 VP7_ROT41 266 SDVLDITADPTTAPQTERMMRINWKKWWQVFYTVVDYVNQIIQLMSKRSRSLNSAAFYYRV 326 SCOP domains ------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------- Transcript 2lm7 A 266 SDVLDITADPTTAPQTERMMRINWKKWWQVFYTVVDYVNQIIQLMSKRSRSLNSAAFYYRV 326 275 285 295 305 315 325
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2LM7) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2LM7) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2LM7) |
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (VP7_ROT41 | Q3ZK60)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|