Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  INTEGRAL MEMBRANE CORE DOMAIN OF THE MERCURY TRANSPORTER MERF IN LIPID BILAYER MEMBRANES
 
Authors :  B. B. Das, H. J. Nothnagel, G. J. Lu, W. Son, S. Park, Y. B. Tian, F. M. Maras S. J. Opella
Date :  03 Sep 11  (Deposition) - 18 Jan 12  (Release) - 15 Feb 12  (Revision)
Method :  SOLID-STATE NMR
Resolution :  NOT APPLICABLE
Chains :  Asym. Unit :  A  (10x)
Biol. Unit 1:  A  (1x)
Keywords :  Membrane Protein, Mercury Transporter, Lipid Bilayers (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  B. B. Das, H. J. Nothnagel, G. J. Lu, W. S. Son, Y. Tian, F. M. Marassi, S. J. Opella
Structure Determination Of A Membrane Protein In Proteoliposomes.
J. Am. Chem. Soc. V. 134 2047 2012
PubMed-ID: 22217388  |  Reference-DOI: 10.1021/JA209464F

(-) Compounds

Molecule 1 - MERF
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainC43
    Expression System Taxid562
    Expression System VariantDE3
    Expression System VectorPET
    FragmentUNP RESIDUES 13-70
    GeneMERF
    Organism ScientificMORGANELLA MORGANII
    Organism Taxid582

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit (10x)A
Biological Unit 1 (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2LJ2)

(-) Sites  (0, 0)

(no "Site" information available for 2LJ2)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2LJ2)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2LJ2)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2LJ2)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2LJ2)

(-) Exons   (0, 0)

(no "Exon" information available for 2LJ2)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:60
 aligned with Q56446_MORMO | Q56446 from UniProtKB/TrEMBL  Length:81

    Alignment length:60
                                    22        32        42        52        62        72
          Q56446_MORMO   13 IGTTLVALCCFTPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADACC 72
               SCOP domains ------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------ Transcript
                  2lj2 A 13 IGTTLVALSSFTPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADASS 72
                                    22        32        42        52        62        72

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2LJ2)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2LJ2)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2LJ2)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A   (Q56446_MORMO | Q56446)
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2lj2)
 
  Sites
(no "Sites" information available for 2lj2)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2lj2)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2lj2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q56446_MORMO | Q56446
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q56446_MORMO | Q56446
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q56446_MORMO | Q564461waz 2h3o 2m67 2moz

(-) Related Entries Specified in the PDB File

1waz RELATED ID: 17914 RELATED DB: BMRB
2h3o